Recombinant Sordaria macrospora Bifunctional lycopene cyclase/phytoene synthase (putative al2)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Identification

  • Gene Name: al2 (alternative names: putative al2, SMAC_01277) .

  • UniProt ID: D1Z4K7 .

  • Domains:

    1. N-terminal Lycopene β-Cyclase (EC 5.5.1.19): Catalyzes cyclization of lycopene to β-carotene.

    2. C-terminal Phytoene Synthase (EC 2.5.1.32): Condenses two GGPP molecules into phytoene, the first carotenoid in the pathway .

Functional Significance in Carotenoid Biosynthesis

The bifunctional enzyme streamlines carotenoid production by merging two sequential enzymatic steps:

Reaction StepSubstrateProductDomain
Phytoene synthesis2× GGPPPhytoeneC-terminal (P)
Lycopene cyclizationLycopeneβ-CaroteneN-terminal (R)
  • Mechanistic Insight: The R domain retains functionality independently, while the P domain requires proper R-domain folding for activity, as observed in homologous fungal systems like Mucor circinelloides .

  • Regulation: Coordinated expression with adjacent carotenoid genes (e.g., phytoene dehydrogenase) suggests light-responsive transcriptional control .

Metabolic Engineering

  • Carotenoid Overproduction: Used in yeast (Yarrowia lipolytica) and fungi to enhance β-carotene yields through heterologous expression .

  • Biotechnological Hosts: Compatibility with E. coli and mammalian systems enables scalable production for industrial applications .

Fungal Development Studies

  • Developmental Link: In S. macrospora, carotenoids may influence fruiting body and ascospore formation, though direct evidence remains under investigation .

Research Findings and Comparative Analysis

  • Heterologous Expression: Successfully complements carotenoid-deficient mutants in M. circinelloides, validating functional conservation across fungi .

  • Evolutionary Context: Bifunctional carotenogenic enzymes are widespread in fungi (e.g., Blakeslea trispora, Neurospora crassa) but absent in plants and bacteria, highlighting fungal metabolic innovation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
SMAC_01277; Bifunctional lycopene cyclase/phytoene synthase [Includes: Lycopene beta-cyclase; Lycopene cyclase; Phytoene synthase; ]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-602
Protein Length
full length protein
Species
Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell)
Target Names
putative
Target Protein Sequence
MYDYAFVHLKFTIPLAVLLTAIAYPVLNRIHVIQTGCLIFIAFTAALPWDAYLIEQKVWS YPPEAIVGPRLLGIPFEELFFFVIQTYITALVYILFNKPVLHALHLNNQRNPPAWMRIAK VTGQLILVALSVWGWKAAQVNQKTTYLGLILVWACPFLLAIWTLAGRFILSLPWFVTVLP VVLPTFYLWAVDELALHRGTWSIGSGTKLEYCLFGKLDIEEATFFLVTNMLIVSGMAVFD QYLAVIYAFPTLFPKVNRYPTPLMLVQSRLVNTTKYDLERIEGLREAVERLRLKSRSFYL ANSLFSGRLRIDLILLYSFCRLADDLVDDAKSRLEVLSWTAKLNHFLDQHYGDSDATEDP KQKAERIDAYIKEAFPPFAYQALHLLPTHILPPKPLYELIKGFEMDSQFTFHGSSDSTNL KFPIAHDKDLKTYAIRVAGTVGELCIALIIHHCLPDMSDSQKRRLESAACRMGIALQYVN IARDILVDAQIGRVYLPTSWLKEEGLTHKAVLDNPEGPEVIEKMRRRLLDNAFELYREAR PEMQQIPSEARGPMIGAVENYMEIGRVLREKKVGQVFVRKEGRATVPKQRRLRTLLRALY EQ
Uniprot No.

Target Background

Function

This bifunctional enzyme catalyzes the conversion of geranylgeranyl diphosphate to phytoene (phytoene synthase activity) and lycopene to β-carotene via the intermediate γ-carotene (lycopene cyclase activity).

Database Links
Protein Families
Lycopene beta-cyclase family; Phytoene/squalene synthase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What makes Sordaria macrospora a valuable model organism for studying chromatin-associated proteins?

Sordaria macrospora serves as an excellent model organism for studying chromatin-associated proteins due to its well-characterized sexual development cycle and tractable genetics. This filamentous ascomycete allows researchers to investigate the roles of chromatin modifiers in both development and DNA damage response pathways. S. macrospora exhibits multicellular fruiting body development, making it ideal for studying how chromatin-associated proteins regulate complex developmental processes. Additionally, the relatively small genome size and availability of genetic manipulation tools facilitate functional studies of specific proteins through targeted gene deletions and complementation experiments .

How do researchers generate and verify deletion mutants in Sordaria macrospora?

Deletion mutants in S. macrospora are typically generated using homologous recombination techniques. The process involves:

  • Designing constructs with resistance markers (e.g., hygromycin resistance) flanked by sequences homologous to the target gene

  • Transformation into S. macrospora protoplasts

  • Selection of primary transformants on medium containing the appropriate antibiotic

  • Crossing primary transformants to obtain homokaryotic strains

  • Verification of gene deletion by PCR analysis

For example, in the study of chromatin-associated proteins, researchers confirmed the deletion of genes like chk2 by PCR validation of the transformants310311. This methodological approach ensures that the observed phenotypes are specifically linked to the deletion of the target gene rather than other genetic factors311.

What growth conditions are optimal for studying sexual development in Sordaria macrospora?

For optimal study of sexual development in S. macrospora, researchers typically culture the fungus on corn meal agar or complete medium agar at 25-27°C under constant light conditions. Sexual development progresses through distinct stages that can be monitored over 7-10 days, from initial hyphal growth to formation of mature perithecia containing ascospores. When assessing developmental phenotypes, it's essential to observe cultures at regular intervals (24-48 hours) to detect any stage-specific arrests313314. Comparative analysis between wild-type and mutant strains should be performed under identical conditions, as environmental factors can significantly influence developmental timing and morphology315.

How do histone chaperones like ASF1 interact with other chromatin-associated proteins to regulate development and DNA damage response in S. macrospora?

The histone chaperone ASF1 functions as a central hub in chromatin modification networks, interacting with multiple partners to coordinate development and DNA damage response in S. macrospora. Research reveals that ASF1 works in close functional association with the histone acetyltransferase RTT109, as evidenced by their similar phenotypes when deleted. Both proteins contribute to:

  • Sexual development - deletion of either gene results in developmental arrest at the same stage

  • Histone acetylation - both are required for H3K56 acetylation

  • DNA damage protection - deletion mutants show similar sensitivity patterns to genotoxic agents

What experimental approaches can resolve contradictory data when studying chromatin protein functions in S. macrospora?

When faced with contradictory data in chromatin protein research, several methodological approaches can help resolve discrepancies:

  • Generate and analyze double mutants: Creating ∆rtt109/∆asf1 double mutants can help determine whether these proteins function in the same or parallel pathways354. Epistasis analysis through phenotypic comparison of single and double mutants provides insights into functional relationships.

  • Employ multiple DNA damage agents: Different genotoxic substances target distinct DNA repair pathways. For example, while ∆asf1 and ∆rtt109 strains show sensitivity to MMS but not HU, ∆chk2 displays the opposite pattern322338. Testing mutants against various agents (MMS, HU, UV radiation) helps create a comprehensive damage response profile.

  • Conduct biochemical assays alongside genetic analyses: Western blot analyses of histone modifications (such as H3K56ac levels) provide crucial biochemical evidence to complement phenotypic observations. ChIP-seq approaches offer higher resolution mapping of protein-DNA interactions and histone modification patterns381.

  • Perform complementation studies with domain mutants: Introducing modified versions of proteins with specific domain mutations can pinpoint which protein interactions or activities are essential for particular functions 377.

Mutant StrainDevelopmental PhenotypeMMS SensitivityHU SensitivityH3K56ac Levels
Wild-typeNormal fruiting bodiesResistantResistantNormal
∆asf1Arrested developmentSensitiveResistantReduced
∆rtt109Arrested developmentSensitiveResistantSeverely reduced/absent
∆chk2Normal fruiting bodiesResistantSensitiveNormal

How can researchers differentiate between direct and indirect effects of chromatin-associated proteins on gene expression during S. macrospora development?

Differentiating between direct and indirect effects of chromatin-associated proteins on gene expression requires multi-layered experimental approaches:

  • Temporal gene expression analysis: RNA-seq at different developmental stages can reveal when expression changes occur relative to phenotypic effects. Primary targets would show altered expression immediately following protein disruption, while secondary effects would appear later.

  • Chromatin immunoprecipitation (ChIP) studies: ChIP experiments can identify direct binding sites of chromatin-associated proteins like RTT109 across the genome. Combined with histone modification analysis (e.g., H3K56ac ChIP-seq), this approach can link protein binding to specific modification patterns and gene expression changes381382.

  • Protein-protein interaction studies: Co-immunoprecipitation experiments help establish direct physical interactions between proteins like ASF1 and RTT109, clarifying whether effects on gene expression occur through direct interactions or via intermediate partners348350.

  • Domain-specific mutant analysis: Creating strains with proteins harboring specific domain mutations can help determine which interactions are necessary for particular functions. For example, ASF1 variants unable to bind histones showed reduced H3K56ac similar to deletion mutants, suggesting this interaction is critical for certain functions378.

What are the optimal protocols for assessing DNA damage sensitivity in S. macrospora deletion mutants?

When assessing DNA damage sensitivity in S. macrospora deletion mutants, researchers should employ standardized protocols that allow for quantitative comparisons:

  • Growth inhibition assays: Culture strains on medium containing increasing concentrations of DNA damaging agents (e.g., MMS at 0.01%, 0.015%, 0.02%; HU at 2.5 mM, 5 mM, 10 mM). Measure colony diameter at regular intervals (24h, 48h, 72h) to quantify growth inhibition322323.

  • Recovery assays: Expose strains to damaging agents for defined periods, then transfer to agent-free medium to assess recovery capabilities. This approach is particularly valuable for distinguishing between temporary growth inhibition and permanent damage337338.

  • Controls and replicates: Always include wild-type strains and previously characterized mutants (e.g., ∆asf1) as reference points. Perform at least three biological replicates under identical conditions to ensure reproducibility323324.

  • Complementation controls: Include strains where the deleted gene has been reintroduced to confirm that observed phenotypes are specifically due to the absence of the target protein. For example, reintroduction of chk2 into ∆chk2 strains complemented the HU sensitivity phenotype335.

  • Time-course analysis: Monitor growth at multiple time points, as some phenotypic differences may only become apparent after extended incubation periods. For instance, ∆chk2 mutants showed growth similar to wild-type during the first 48 hours under HU stress but ceased growing thereafter, while wild-type continued to grow337.

What techniques are most effective for analyzing histone modifications in S. macrospora?

For comprehensive analysis of histone modifications in S. macrospora, researchers should consider a multi-faceted approach:

  • Western blot analysis: Provides semi-quantitative assessment of global histone modification levels. For detecting H3K56ac, specific antibodies against the acetylated form of H3K56 are used, with total H3 or H4 levels serving as loading controls.

  • ChIP-seq: Offers genome-wide mapping of histone modifications at high resolution. This approach is particularly valuable for identifying locus-specific changes that may not be detected by global analyses and for correlating modification patterns with gene expression data381.

  • Mass spectrometry: Provides comprehensive, unbiased identification of histone modifications and their combinations. This technique can reveal novel or unexpected modifications that might be missed by antibody-based approaches.

  • Immunofluorescence microscopy: Allows visualization of the spatial distribution of histone modifications within nuclei during different developmental stages. This approach can reveal stage-specific or cell-type-specific patterns that might be diluted in whole-cell extracts.

  • In vitro histone modification assays: Using purified components (e.g., RTT109, ASF1, and histone substrates), researchers can directly assess enzymatic activities and protein-protein interactions required for specific modifications. These assays help distinguish between direct and indirect effects on histone modification patterns382383.

How can researchers effectively compare chromatin modification systems between S. macrospora and other model organisms?

Comparative analysis of chromatin modification systems between S. macrospora and other organisms requires systematic approaches:

  • Phylogenetic analysis: Construct comprehensive phylogenetic trees of chromatin-associated proteins to identify true orthologs across species. For example, the S. macrospora CHK2 is more closely related to human CHK2 and N. crassa PRD-4 than to S. cerevisiae RAD53, despite functional similarities298299.

  • Domain structure comparison: Analyze protein domain architectures to identify conserved and divergent features. This approach revealed that while S. cerevisiae has two homologs (RAD53 and DUN1), filamentous fungi like S. macrospora and N. crassa have a single checkpoint kinase (CHK2/PRD-4) that is more similar to human CHK2 in domain structure301302.

  • Heterologous complementation assays: Test whether proteins from one organism can rescue mutants in another. N. crassa PRD-4 and human CHK2 can complement S. cerevisiae ∆rad53 mutants, demonstrating functional conservation despite sequence divergence303304.

  • Comparative phenotypic analysis: Systematically compare phenotypes of orthologous gene deletions across species. While PRD-4 deletion in N. crassa causes sensitivity to MMS, the S. macrospora CHK2 deletion does not affect MMS resistance, revealing species-specific functional differences324325.

OrganismCheckpoint KinaseMMS SensitivityHU SensitivityDevelopment Role
S. macrosporaCHK2NoYesNo
N. crassaPRD-4YesYesNo
S. cerevisiaeRAD53YesYesN/A
S. cerevisiaeDUN1PartialPartialN/A
HumanCHK2YesVariableN/A

What are the most promising research avenues for further elucidating chromatin-associated protein functions in S. macrospora?

Based on current knowledge gaps, several promising research directions emerge for studying chromatin-associated proteins in S. macrospora:

  • Genome-wide mapping of histone modifications: Implementing ChIP-seq to create comprehensive maps of histone modifications (H3K56ac and others) in wild-type and mutant strains would provide deeper insights into how proteins like RTT109 and ASF1 influence chromatin structure throughout the genome381.

  • Proteomic identification of interaction networks: Using techniques like BioID or proximity-dependent labeling to identify the complete set of proteins that interact with ASF1, RTT109, and CHK2 under normal and stress conditions would help elucidate the broader chromatin modification network in S. macrospora346347.

  • Single-cell approaches: Implementing single-cell RNA-seq or single-nucleus ATAC-seq would reveal cell-type-specific roles of chromatin-associated proteins during multicellular development, potentially explaining the developmental arrest phenotypes observed in deletion mutants351352.

  • Conditional mutants and temporal studies: Developing systems for conditional protein depletion would allow researchers to determine exactly when during development specific chromatin-associated proteins are required, distinguishing between early and late functions374375.

  • Investigation of potential redundancy: The lack of phenotype in some deletion mutants (e.g., ∆chk2 shows normal development) could be due to redundancy with other proteins. Systematic double-mutant analyses would help identify compensatory mechanisms and parallel pathways326327.

  • Cross-kingdom comparative analysis: Expanding comparative studies beyond fungi to include plant and animal systems would provide evolutionary insights into the conservation and divergence of chromatin regulation mechanisms across eukaryotes301302.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.