Recombinant Sorex unguiculatus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

What is MT-ND4L and what is its role in mitochondrial function?

MT-ND4L is a mitochondrially encoded gene that provides instructions for making NADH dehydrogenase 4L protein, a critical component of Complex I in the electron transport chain. This protein is embedded in the inner mitochondrial membrane and participates in the first step of electron transport during oxidative phosphorylation. Specifically, MT-ND4L contributes to the transfer of electrons from NADH to ubiquinone, which is essential for ATP production .

In Sorex unguiculatus (Long-clawed shrew), the MT-ND4L protein consists of 98 amino acids with the sequence: MSLVHMNIALAFTVALLGLLMYRSHLMSSLLCLEGMMLTLFIMGTIMILNTHFTLASMLPIILLVFAACEAAVGLSLLVMVSNTYGVDYVQNLNLLQC . It forms part of the core hydrophobic transmembrane domain of Complex I, which is essential for proper proton translocation across the inner mitochondrial membrane.

How does the structure of Sorex unguiculatus MT-ND4L compare to human MT-ND4L?

While both proteins serve similar functions in the respiratory chain, there are notable structural differences:

The proteins share conserved hydrophobic domains essential for membrane insertion and electron transport function, but species-specific variations exist that may affect protein-protein interactions within Complex I .

What are the optimal storage and handling conditions for recombinant MT-ND4L?

For optimal preservation of recombinant Sorex unguiculatus MT-ND4L:

• Store at -20°C for regular use

• For extended storage, maintain at -20°C or -80°C

• Use a Tris-based buffer with 50% glycerol, optimized for protein stability

• Avoid repeated freeze-thaw cycles as this significantly degrades protein structure and function

• For working experiments, store aliquots at 4°C for up to one week

• When handling, maintain cold chain to prevent denaturation

These conditions ensure maintenance of protein conformation and enzymatic activity, which is critical for experimental reproducibility and reliable results.

How do mutations in MT-ND4L affect mitochondrial function across species?

Mutations in MT-ND4L can significantly impact mitochondrial function, with effects that vary across species:

In humans, the T10663C (Val65Ala) mutation in MT-ND4L has been identified in families with Leber hereditary optic neuropathy (LHON). This mutation replaces the amino acid valine with alanine at position 65, disrupting normal Complex I activity in the mitochondrial inner membrane and affecting ATP production particularly in retinal ganglion cells with high energy demands .

Research comparing mutations across species reveals:

• Functional impact varies based on the specific position within conserved domains

• Heteroplasmy levels (proportion of mutated mtDNA) correlate with phenotype severity

• Tissue-specific effects depend on metabolic demands and mitochondrial density

• Compensatory mechanisms differ between species, affecting manifestation of dysfunction

For example, studies in mice with heteroplasmic mitochondrial gene knockouts demonstrate:

• Reduced oxygen consumption rates

• Impaired ATP synthesis

• Decreased heat production

• Thermogenic disorders in brown adipose tissue-dependent processes

These cross-species comparisons provide valuable insights into evolutionary conservation of MT-ND4L function and the pathogenic mechanisms of specific mutations.

What experimental models are best suited for studying MT-ND4L-related oxidative phosphorylation defects?

Several experimental models have proven effective for studying MT-ND4L-related defects:

• Cell-based models:

  • Mouse embryonic fibroblasts (MEFs) derived from heteroplasmic knockouts show significantly lower oxygen consumption rates compared to wild-type MEFs, providing a controlled system for studying mitochondrial dysfunction

  • Human cybrid cell lines permit analysis of mutation effects in a consistent nuclear background

• Animal models:

  • Heteroplasmic MT-ND4L knockout mice exhibit phenotypes including reduced metabolic capacity, decreased thermogenesis, and neurological deficits

  • C. elegans models allow for high-throughput screening of genetic and pharmacological interventions

• Tissue explants:

  • Muscle biopsies provide directly relevant tissue for assessing mitochondrial function

  • Brain slices allow for evaluation of mitochondrial dysfunction in neural circuits

• In vitro reconstitution systems:

  • Isolated mitochondria preparations enable direct measurement of respiratory chain activity

  • Liposome-reconstituted Complex I with incorporated recombinant MT-ND4L allows structure-function analysis

When selecting a model, researchers should consider:

• The specific research question (protein interaction, pathogenic mechanism, therapeutic screening)

• Required throughput

• Available analytical techniques

• Relevance to human disease

Methods for assessing MT-ND4L function include Complex I activity assays (NADH-Ubiquinone Oxidoreductase method), oxygen consumption measurements, and mitochondrial membrane potential assessments .

How can researchers interpret contradictory findings related to MT-ND4L function across different species?

Researchers frequently encounter contradictory findings when studying MT-ND4L across species. A methodological approach to resolving these contradictions includes:

• Consider evolutionary context:

  • Analyze sequence conservation across phylogenetic trees

  • Identify species-specific adaptations that may affect protein function

  • Assess compensatory mutations that may mask phenotypic effects

• Evaluate experimental conditions:

  • Different assay conditions (pH, temperature, ionic strength) can affect results

  • Standardize protocols when comparing across studies

  • Verify antibody specificity when using immunological detection methods

• Account for heteroplasmy effects:

  • The percentage of mutant mitochondrial DNA significantly impacts phenotype severity

  • Establish quantitative relationships between mutation load and functional impairment

  • Consider tissue-specific segregation of mitochondrial populations

• Harmonize analytical techniques:

  • Use multiple complementary methods to assess function (biochemical, genetic, proteomic)

  • Establish appropriate statistical frameworks for data integration

  • Apply molecular dynamics simulations to predict functional consequences of specific variants

For example, analysis of mitochondrial DNA in Sardinella longiceps across different eco-regions revealed significant variations in MT-ND genes with evidence of positive selection in specific codons, demonstrating how environmental factors can drive divergent evolution of these genes . Similarly, contradictory findings in human studies may reflect population-specific variants or environmental influences.

What controls should be included when assessing MT-ND4L activity in Complex I assays?

Proper controls are critical for reliable assessment of MT-ND4L activity in Complex I:

Essential controls for Complex I activity assays:

• Positive controls:

  • Commercial purified Complex I with known activity

  • Wild-type recombinant MT-ND4L from the same species

  • Tissue samples with verified normal Complex I function

• Negative controls:

  • Samples treated with specific Complex I inhibitors (rotenone, piericidin A)

  • Heat-denatured enzyme preparations

  • Samples from models with known Complex I deficiency

• Normalization controls:

  • Citrate synthase activity measurements to normalize for mitochondrial content

  • Total protein quantification

  • Activity of other respiratory chain complexes (II-V) for comparative analysis

• Technical validation:

  • Standard curves with varying substrate concentrations

  • Time-course measurements to ensure linearity

  • Replicate measurements to establish variability

• Specificity controls:

  • Antibody validation for immunodetection methods

  • Gene silencing or knockout to confirm specificity of observed effects

  • Rescue experiments with wild-type MT-ND4L to demonstrate functional complementation

Complex I activity is typically measured using the NADH-Ubiquinone Oxidoreductase method with spectrophotometric detection, monitoring the decrease in NADH absorbance at 340 nm . This should be combined with other functional assessments such as oxygen consumption measurements and membrane potential assays for comprehensive analysis.

How can researchers effectively incorporate recombinant MT-ND4L into reconstituted systems?

Incorporating hydrophobic membrane proteins like MT-ND4L into reconstituted systems requires specialized approaches:

• Preparation of recombinant protein:

  • Express in systems that handle membrane proteins well (E. coli C41/C43 strains, insect cells)

  • Include fusion tags that aid solubility while preserving function

  • Maintain proper folding with appropriate chaperones during expression

  • Purify in detergent micelles that mimic native membrane environment

  • Verify protein quality by circular dichroism and size-exclusion chromatography

• Reconstitution strategies:

  • Liposome incorporation:

    • Use lipid compositions that match mitochondrial inner membrane

    • Control protein:lipid ratios carefully

    • Employ gentle detergent removal techniques (dialysis, Bio-Beads)

  • Nanodiscs:

    • Create uniform membrane mimetics with controlled size

    • Allow precise control of protein stoichiometry

    • Enable single-molecule studies

• Verification methods:

  • Proteoliposome flotation assays to confirm incorporation

  • Freeze-fracture electron microscopy to visualize distribution

  • Functional assays to verify orientation and activity

• Assembly of multiprotein complexes:

  • Sequential incorporation of purified components

  • Co-expression strategies for interacting subunits

  • Stabilization of assembled complexes with chemical crosslinking

• Analytical considerations:

  • Account for potential differences between detergent-solubilized and membrane-embedded states

  • Verify proper folding in the reconstituted system

  • Assess lateral mobility and distribution within the membrane

When working with Sorex unguiculatus MT-ND4L specifically, researchers should consider its highly hydrophobic nature and the 98-amino acid sequence for optimizing expression and reconstitution protocols .

What precautions should be taken when designing experiments to study MT-ND4L in oxidative stress models?

When studying MT-ND4L in oxidative stress models, several critical precautions are necessary:

• Model selection considerations:

  • Choose models with relevant oxidative stress mechanisms

  • Consider tissue-specific effects (brain, heart, liver have different mitochondrial densities)

  • Account for species differences in antioxidant defenses

• Experimental design factors:

  • Include time-course analyses to distinguish acute vs. chronic effects

  • Use multiple oxidative stress inducers (t-BHP, H₂O₂, paraquat) to verify consistency

  • Control for non-specific effects of stressors on cellular function

• Analytical precautions:

  • Use multiple, complementary methods to measure reactive oxygen species (ROS)

  • Distinguish mitochondrial from cytosolic ROS production

  • Measure both oxidative damage markers and antioxidant responses

  • Control for potential artifacts in ROS detection methods

• Mitochondrial function assessments:

  • Measure changes in Complex I activity using standardized methods

  • Assess mitochondrial membrane potential and ATP production

  • Quantify mitochondrial DNA damage using PCR-based methods

  • Evaluate mitochondrial morphology and distribution

• Controls and validations:

  • Include antioxidant treatments as protective controls

  • Use Complex I inhibitors to distinguish direct from indirect effects

  • Verify specificity through genetic approaches (siRNA, CRISPR)

  • Include proper statistical analyses for testing significance of observed changes

Studies using ATM+/− cells demonstrated increased micronuclei formation and DNA fragmentation in response to oxidative stress, along with altered rates of proliferation and apoptosis. These methods provide a framework for studying MT-ND4L's role in response to oxidative damage .

What techniques are most effective for studying MT-ND4L sequence variations and their functional consequences?

Researchers investigating MT-ND4L sequence variations can employ several advanced techniques:

• Sequencing approaches:

  • Next-generation sequencing enables high-throughput detection of variants

  • Long-read sequencing technologies help resolve complex rearrangements

  • Single-cell sequencing reveals heteroplasmy at the cellular level

  • Targeted deep sequencing allows detection of low-frequency variants

• Functional assessment methods:

  • Blue Native PAGE separates intact respiratory complexes

  • In-gel activity assays measure complex-specific enzymatic function

  • High-resolution respirometry quantifies oxygen consumption in intact cells

  • Seahorse XF analyzers measure real-time cellular bioenergetics

• Structural biology techniques:

  • Cryo-electron microscopy reveals how variants affect protein structure

  • Hydrogen/deuterium exchange mass spectrometry analyzes conformational changes

  • Molecular dynamics simulations predict functional impacts of specific mutations

• Gene editing approaches:

  • Mitochondrially targeted nucleases enable specific mtDNA editing

  • DdCBE (DddA-derived cytosine base editors) can create precise point mutations in mtDNA, as demonstrated in mouse models of MT-ND5 knockout

  • CRISPR-free base editing technologies for modeling disease-associated variants

• Expression systems:

  • Allotopic expression of wild-type and variant MT-ND4L

  • Cybrid cell technology to study variants in consistent nuclear backgrounds

  • Transmitochondrial mice for in vivo modeling of mtDNA variants

These approaches can be applied to study the T10663C mutation in MT-ND4L associated with Leber hereditary optic neuropathy , as well as other variants of uncertain significance. Research has shown that precise editing of mitochondrial genes can produce heteroplasmic knockout mice with significant physiological phenotypes, demonstrating the feasibility of creating specific MT-ND4L variants for functional studies .

How should researchers account for heteroplasmy when studying mitochondrial genes like MT-ND4L?

Heteroplasmy—the presence of mixed populations of normal and mutant mtDNA—significantly complicates mitochondrial gene research and requires specialized approaches:

• Quantification methods:

  • Pyrosequencing provides accurate mutation load assessment

  • Digital droplet PCR enables absolute quantification of variant percentages

  • Next-generation sequencing with high depth offers comprehensive heteroplasmy profiling

  • Single-cell analysis reveals cellular distribution of heteroplasmy

• Experimental design considerations:

  • Establish heteroplasmy thresholds for phenotypic expression

  • Monitor drift in heteroplasmy levels during cell culture

  • Account for tissue-specific segregation of mitochondrial populations

  • Consider maternal inheritance patterns in animal models

• Analytical approaches:

  • Correlate phenotype severity with heteroplasmy percentage

  • Apply regression analyses to establish threshold effects

  • Use mathematical modeling to predict heteroplasmy dynamics

  • Employ single-cell transcriptomics to assess cell-to-cell variation

• Controls and validations:

  • Generate isogenic lines with varying heteroplasmy levels

  • Create artificial mixes of wild-type and mutant mtDNA as standards

  • Use cybrid cell lines with defined heteroplasmy percentages

  • Include tissue-matched controls for comparative analyses

In studies of MT-ND5 heteroplasmic knockout mice, researchers demonstrated significant phenotypic effects including decreased oxygen consumption, brain damage, and thermoregulation defects. These models provide valuable insights into how heteroplasmy in respiratory chain components affects physiological function .

Statistical approaches like AMOVA (Analysis of Molecular Variance) can help assess genetic differentiation in mitochondrial sequences, as demonstrated in studies of S. longiceps populations where significant ΦST values indicated population structure in mtDNA .

What approaches can researchers use to study interactions between MT-ND4L and other subunits of Complex I?

Investigating protein-protein interactions within the membrane-embedded Complex I requires specialized techniques:

• Structural biology approaches:

  • Cryo-electron microscopy has revolutionized visualization of membrane protein complexes

  • X-ray crystallography of purified complexes reveals atomic-level interactions

  • NMR spectroscopy of specifically labeled domains identifies contact points

• Biochemical methods:

  • Chemical crosslinking coupled with mass spectrometry maps interaction interfaces

  • Co-immunoprecipitation identifies stable interaction partners

  • Blue Native PAGE preserves native protein complexes for interaction studies

  • FRET/BRET technologies detect proximity between labeled subunits

• Genetic approaches:

  • Suppressor mutation analysis identifies compensatory changes

  • Correlated mutation analysis reveals co-evolving residues

  • Synthetic lethal screens identify functional dependencies

• Computational techniques:

  • Molecular dynamics simulations predict dynamic interactions

  • Protein-protein docking models potential binding configurations

  • Evolutionary coupling analysis identifies co-evolving residue networks

  • AlphaFold and similar tools predict structural interactions

• Functional validation methods:

  • Site-directed mutagenesis of predicted interface residues

  • Assembly assays to monitor complex formation

  • Activity measurements to assess functional consequences of disrupted interactions

MT-ND4L is one of seven mitochondrially encoded subunits that form the core of the hydrophobic transmembrane domain of Complex I, alongside MT-ND1, MT-ND2, MT-ND3, MT-ND4, MT-ND5, and MT-ND6 . The interactions between these subunits are critical for proton pumping and electron transfer functions of the complex.

Of particular interest is the unusual genetic arrangement in human mtDNA where MT-ND4L overlaps with MT-ND4 by 7 nucleotides, suggesting potential co-regulation and functional interaction between these proteins .

How is research on MT-ND4L contributing to our understanding of mitochondrial diseases?

Research on MT-ND4L is advancing our understanding of mitochondrial diseases through several key contributions:

• Disease mechanism insights:

  • Identified specific mutations like T10663C (Val65Ala) in MT-ND4L associated with Leber hereditary optic neuropathy (LHON)

  • Demonstrated how these mutations disrupt Complex I activity and mitochondrial function

  • Revealed tissue-specific vulnerabilities to mitochondrial dysfunction, particularly in high-energy-demanding tissues like the retina and brain

• Genotype-phenotype correlations:

  • Established relationships between mutation type, heteroplasmy level, and clinical manifestations

  • Identified factors that modify disease expression (nuclear genetic background, environmental factors)

  • Created frameworks for predicting disease severity based on molecular characteristics

• Model systems development:

  • Generated heteroplasmic knockout models that recapitulate disease features

  • Developed cell-based systems for testing potential therapeutics

  • Created tools for precise mitochondrial genome editing to model specific mutations

• Therapeutic target identification:

  • Characterized specific dysfunctions in electron transport that could be therapeutically targeted

  • Identified compensatory mechanisms that might be enhanced to bypass defects

  • Developed biomarkers for monitoring disease progression and treatment response

Recent experimental approaches have demonstrated that targeted mtDNA editing is feasible, opening possibilities for direct correction of pathogenic MT-ND4L mutations. For example, DdCBE-mediated editing has been used to create specific mutations in mitochondrial genes of mice, producing phenotypes with clear mitochondrial dysfunction that can serve as disease models .

Future research will likely focus on developing gene therapy approaches for MT-ND4L-related diseases, identifying small molecules that can bypass Complex I defects, and understanding how nuclear-mitochondrial genetic interactions influence disease manifestation.

What are the current methodological challenges in analyzing MT-ND4L function in different experimental systems?

Researchers face several methodological challenges when studying MT-ND4L function:

• Technical limitations:

  • Difficulty in expressing and purifying hydrophobic membrane proteins

  • Challenges in maintaining native conformation during isolation

  • Limited availability of specific antibodies for detection

  • Interference from nuclear-encoded pseudogenes in some analytical approaches

• Experimental system constraints:

  • Cell culture models may not recapitulate tissue-specific effects

  • Animal models may show species-specific differences in mitochondrial function

  • In vitro reconstitution systems lack the complexity of cellular environments

  • Clinical samples often have limited availability and heterogeneous quality

• Analytical challenges:

  • Distinguishing direct MT-ND4L effects from secondary consequences

  • Accurately measuring heteroplasmy at the single-cell level

  • Quantifying subtle functional changes in Complex I activity

  • Separating MT-ND4L function from interdependent subunit effects

• Data interpretation issues:

  • Conflicting results across different experimental systems

  • Variability in mitochondrial isolation protocols affecting reproducibility

  • Difficulties in translating findings between model systems and human disease

  • Accurately assessing the pathogenicity of novel variants

Recent methodological advances are addressing these challenges, including:

• Improved mitochondrial isolation techniques that preserve native protein interactions

• Advanced imaging methods for visualizing mitochondrial dynamics

• Development of sensitive Complex I activity assays

• Precise mtDNA editing technologies for creating model systems

As technologies continue to evolve, researchers should focus on standardizing protocols, validating findings across multiple systems, and developing integrated approaches that combine structural, functional, and genetic analyses.

How might comparative studies of MT-ND4L across different species advance our understanding of mitochondrial evolution?

Comparative studies of MT-ND4L across species provide valuable insights into mitochondrial evolution:

• Evolutionary conservation patterns:

  • Identification of highly conserved functional domains across diverse lineages

  • Recognition of species-specific adaptations to different metabolic demands

  • Understanding of co-evolution with nuclear-encoded Complex I subunits

  • Mapping of selection pressures on different regions of the protein

• Adaptive significance:

  • Correlation of sequence variations with environmental adaptations (temperature, metabolic rate)

  • Identification of positive selection signatures in specific ecological contexts

  • Understanding of how MT-ND4L variations contribute to metabolic adaptations

• Methodological approaches:

  • Phylogenetic analyses to trace evolutionary history

  • Tests for selection (dN/dS ratios, FUBAR, MEME, FEL, SLAC methods)

  • Analysis of Molecular Variance (AMOVA) to assess population structure

  • Comparison of nuclear and mitochondrial evolutionary rates

• Research applications:

  • Using evolutionary insights to predict functional impacts of human variants

  • Identifying naturally occurring compensatory mechanisms that could inform therapeutic approaches

  • Understanding how environmental factors drive mitochondrial adaptation

Studies of Sardinella longiceps across different eco-regions have revealed significant variations in mitochondrial genes with evidence of positive selection in specific codons of OXPHOS complexes, demonstrating how environmental factors can drive divergent evolution of these genes . Similar approaches could be applied to study MT-ND4L evolution.

The unusual genetic arrangement in human mtDNA where MT-ND4L overlaps with MT-ND4 by 7 nucleotides suggests potential co-evolutionary constraints that may have functional significance . Comparative analysis of this arrangement across species could reveal insights into the evolutionary history and functional interdependence of these genes.

What are the recommended protocols for analyzing MT-ND4L expression and activity?

Comprehensive analysis of MT-ND4L requires multiple complementary approaches:

Expression Analysis Protocols:

• RT-qPCR for transcript quantification:

  • RNA extraction using specialized kits for mitochondrial RNA

  • cDNA synthesis with random hexamers or specific primers

  • qPCR with MT-ND4L-specific primers (e.g., Nd4.F 5′-CTACGTACATAACCTAAACC-3′, Nd4.R 5′-CTGATGTTTTGGTTAAAC-3′)

  • Normalization to stable mitochondrial reference genes

• Western blotting for protein quantification:

  • Mitochondrial isolation using differential centrifugation

  • Sample preparation in suitable detergents to solubilize membrane proteins

  • Resolution on Tricine-SDS-PAGE gels optimized for small hydrophobic proteins

  • Transfer to PVDF membranes using specific protocols for hydrophobic proteins

  • Detection with validated antibodies against MT-ND4L

Activity Assessment Protocols:

• Complex I enzymatic activity:

  • Spectrophotometric NADH-Ubiquinone Oxidoreductase assay

  • Monitoring NADH oxidation at 340 nm

  • Rotenone-sensitive activity determination

  • Normalization to citrate synthase activity

• Respiratory chain function:

  • High-resolution respirometry to measure oxygen consumption

  • Substrate-inhibitor protocols to isolate Complex I contribution

  • Seahorse XF analysis for real-time cellular bioenergetics

• ROS production assessment:

  • Site-specific ROS detection using targeted probes

  • Distinction between forward and reverse electron transport-associated ROS

  • Correlation with MT-ND4L variants or expression levels

Specific considerations for Sorex unguiculatus MT-ND4L:

• Optimize primers based on the specific sequence (MSLVHMNIALAFTVALLGLLMYRSHLMSSLLCLEGMMLTLFIMGTIMILNTHFTLASMLPIILLVFAACEAAVGLSLLVMVSNTYGVDYVQNLNLLQC)

• Consider species-specific antibody validation

• Adjust assay conditions based on biochemical properties of the protein

These protocols should be adapted based on the specific research question, available resources, and experimental system being used.

How can researchers effectively use recombinant MT-ND4L for structural and functional studies?

Recombinant MT-ND4L offers valuable opportunities for structural and functional studies when used appropriately:

Structural Studies Applications:

• Protein preparation for structural biology:

  • Expression in specialized systems (E. coli strains C41/C43, insect cells)

  • Purification in mild detergents that preserve native conformation

  • Reconstitution into nanodiscs or liposomes for membrane environment

  • Sample preparation for cryo-EM, NMR, or crystallography

• Structural characterization methods:

  • Circular dichroism to assess secondary structure elements

  • NMR for dynamic structural information

  • Hydrogen-deuterium exchange mass spectrometry for conformational studies

  • Cross-linking mass spectrometry to identify interaction surfaces

Functional Studies Applications:

• Reconstitution assays:

  • Incorporation into proteoliposomes for functional assessments

  • Measurement of proton pumping activity

  • Assessment of electron transfer capability

  • Evaluation of inhibitor binding properties

• Interaction studies:

  • Pull-down assays with other Complex I subunits

  • Surface plasmon resonance for binding kinetics

  • Co-expression with interacting partners

  • Fluorescence-based interaction assays

• Mutational analysis:

  • Site-directed mutagenesis to study structure-function relationships

  • Alanine-scanning mutagenesis to identify critical residues

  • Creation of disease-associated variants for functional comparison

  • Chimeric constructs to identify domain-specific functions

Methodological considerations for Sorex unguiculatus MT-ND4L:

• Store recombinant protein at -20°C for regular use or -80°C for extended storage

• Use Tris-based buffer with 50% glycerol for optimal stability

• Avoid repeated freeze-thaw cycles

• For working experiments, maintain aliquots at 4°C for up to one week

When designing experiments with recombinant MT-ND4L, researchers should carefully consider the specific tag used during production, as this can affect protein folding and function. The recombinant protein's properties should be thoroughly characterized and compared to the native protein to ensure physiological relevance of the findings.