Recombinant Sorghum bicolor 4-hydroxyphenylacetaldehyde oxime monooxygenase (CYP71E1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Note: Tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
CYP71E1; 4-hydroxyphenylacetaldehyde oxime monooxygenase; Cytochrome P450 71E1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-531
Protein Length
full length protein
Species
Sorghum bicolor (Sorghum) (Sorghum vulgare)
Target Names
CYP71E1
Target Protein Sequence
MATTATPQLLGGSVPQQWQTCLLVLLPVLLVSYYLLTSRSRNRSRSGKLGGAPRLPPGPA QLPILGNLHLLGPLPHKNLRELARRYGPVMQLRLGTVPTVVVSSAEAAREVLKVHDVDCC SRPASPGPKRLSYDLKNVGFAPYGEYWREMRKLFALELLSMRRVKAACYAREQEMDRLVA DLDRAAASKASIVLNDHVFALTDGIIGTVAFGNIYASKQFAHKERFQHVLDDAMDMMASF SAEDFFPNAAGRLADRLSGFLARRERIFNELDVFFEKVIDQHMDPARPVPDNGGDLVDVL INLCKEHDGTLRFTRDHVKAIVLDTFIGAIDTSSVTILWAMSELMRKPQVLRKAQAEVRA AVGDDKPRVNSEDAAKIPYLKMVVKETLRLHPPATLLVPRETMRDTTICGYDVPANTRVF VNAWAIGRDPASWPAPDEFNPDRFVGSDVDYYGSHFELIPFGAGRRICPGLTMGETNVTF TLANLLYCYDWALPGAMKPEDVSMEETGALTFHRKTPLVVVPTKYKNRRAA
Uniprot No.

Target Background

Function

This enzyme catalyzes the conversion of p-hydroxyphenylacetaldoxime to p-hydroxymandelonitrile. This process involves the dehydration of the oxime to the corresponding nitrile, followed by C-hydroxylation of the nitrile to yield p-hydroxymandelonitrile.

Database Links

UniGene: Sbi.14205

Protein Families
Cytochrome P450 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is CYP71E1 and what is its biochemical function in Sorghum bicolor?

CYP71E1 is a multifunctional cytochrome P450 monooxygenase that catalyzes two sequential reactions in the biosynthetic pathway of the cyanogenic glucoside dhurrin in Sorghum bicolor. Specifically, it converts p-hydroxyphenylacetaldoxime to p-hydroxymandelonitrile through a two-step process:

  • Dehydration of the oxime to form the corresponding nitrile (p-hydroxyphenylacetonitrile)

  • Subsequent C-hydroxylation of the nitrile to produce p-hydroxymandelonitrile

This enzyme is part of a metabolic channel that prevents the accumulation of toxic intermediates in the dhurrin biosynthetic pathway. The catalytic efficiency of CYP71E1 is sufficient to prevent the accumulation of the intermediates when radiolabeled tyrosine is administered to sorghum seedlings .

How does CYP71E1 fit into the complete dhurrin biosynthetic pathway?

The biosynthesis of dhurrin involves a series of enzymes working in concert:

  • CYP79A1: Catalyzes the conversion of tyrosine to p-hydroxyphenylacetaldehyde oxime (the rate-limiting step)

  • CYP71E1: Converts p-hydroxyphenylacetaldehyde oxime to p-hydroxymandelonitrile through the two reactions described above

  • UDP-glucosyltransferase (UGT85B1): Catalyzes the glucosylation of p-hydroxymandelonitrile to form dhurrin

The pathway demonstrates tight coregulation between CYP79A1 and CYP71E1, with the activity of CYP79A1 always being rate-limiting . This coordination prevents the accumulation of toxic intermediates and is further secured by metabolic channeling between the enzymes . Figure 1 from search result illustrates this pathway, showing the sequential enzymatic conversions from tyrosine to dhurrin.

How was CYP71E1 initially identified and isolated?

CYP71E1 was isolated using a PCR-based approach targeting three consensus sequences common to A-type cytochromes P450:

  • (V/I)KEX(L/F)R

  • FXPERF

  • PFGXGRRXCXG

This approach yielded three novel cytochromes P450 (CYP71E1, CYP98, and CYP99) plus a PCR fragment encoding sorghum cinnamic acid 4-hydroxylase . The identity of CYP71E1 was confirmed through reconstitution experiments with the recombinant enzyme heterologously expressed in Escherichia coli, combined with sorghum NADPH-cytochrome P450-reductase in L-alpha-dilaurylphosphatidyl choline micelles. These experiments verified that CYP71E1 catalyzes the conversion of p-hydroxyphenylacetaldoxime to p-hydroxymandelonitrile .

What are the optimal expression systems and conditions for producing functional recombinant CYP71E1?

Based on the literature, several expression systems have been successfully used for CYP71E1:

Expression SystemAdvantagesLimitationsKey Success Factors
E. coliHigh yield, cost-effective, rapid growthLimited post-translational modifications; only partially functional in vivoCo-expression with sorghum NADPH-cytochrome P450-reductase; use of L-α-dilaurylphosphatidyl choline micelles for reconstitution
Yeast (S. cerevisiae WAT11)Better folding of membrane proteins, presence of microsomal systemSlower growth than E. coliExpression in strains engineered to express NADPH-cytochrome P450-reductase (e.g., WAT11 strain)
Nicotiana benthamiana (transient)Native plant cellular environment, proper foldingLower yield compared to microbial systemsCo-expression with silencing suppressor p19; harvest 4-5 weeks after infiltration

For functional expression in E. coli, it's noteworthy that the flavodoxin/flavodoxin reductase system in E. coli appears to support only the dehydration reaction catalyzed by CYP71E1 (oxime to nitrile) but not the subsequent C-hydroxylation reaction . For full functionality, reconstitution with the sorghum NADPH-cytochrome P450-reductase is required.

What methods are most effective for measuring CYP71E1 catalytic activity?

Multiple analytical approaches can be employed to measure CYP71E1 activity:

  • Gas Chromatography-Mass Spectrometry (GC-MS):

    • Allows detection and quantification of both substrates and products

    • Can distinguish between the E and Z isomers of p-hydroxyphenylacetaldehyde oxime

    • Used successfully to monitor CYP71AM1 (another CYP71 enzyme) activity with methylated resorcinol substrates

  • Quantification of Hydrogen Cyanide Release:

    • Colorimetric assays to measure HCN production as a proxy for pathway activity

    • Useful for measuring the combined activity of CYP79A1 and CYP71E1

  • Radiolabeled Substrate Tracing:

    • Administration of [UL-14C]tyrosine and monitoring conversion to p-hydroxymandelonitrile

    • Sensitive technique for detecting low levels of activity

  • Microsomal Enzyme Assays:

    • Preparation of microsomes from plant tissues or heterologous expression systems

    • In vitro reconstitution with purified NADPH-cytochrome P450-reductase

    • Requires NADPH and oxygen for activity

For optimal in vitro activity measurement, a reaction mixture containing the following components is typically used:

  • Recombinant CYP71E1

  • Sorghum NADPH-cytochrome P450-reductase

  • L-α-dilaurylphosphatidyl choline

  • NADPH regenerating system

  • Appropriate buffer system (pH ~7.4)

  • p-hydroxyphenylacetaldehyde oxime substrate

How do the E and Z isomers of p-hydroxyphenylacetaldehyde oxime affect CYP71E1 activity?

The geometric isomerism of p-hydroxyphenylacetaldehyde oxime plays a crucial role in the enzymatic activity of CYP71E1:

  • CYP79A1 produces primarily the E-isomer of p-hydroxyphenylacetaldehyde oxime

  • CYP71E1 uses the E-isomer as its substrate

  • The E-isomer is enzymatically converted to the Z-isomer during the reaction process

  • The Z-isomer is then further processed to form p-hydroxymandelonitrile

This isomeric preference has important implications for experimental design. Researchers synthesizing substrates for CYP71E1 assays need to consider the stereochemistry carefully. A convenient route for chemical synthesis of both E- and Z-p-hydroxyphenylacetaldehyde oxime has been reported, using p-hydroxyphenylacetic acid as a starting material . This synthesis proceeds with excellent yield under mild conditions and is scalable for research purposes.

For accurate kinetic studies, researchers should use either purified isomers or account for the isomeric ratio in their substrate preparations.

What research strategies can be used to study the structure-function relationship of CYP71E1's dual catalytic activities?

CYP71E1's ability to catalyze both dehydration and hydroxylation reactions makes it an interesting subject for structure-function studies. Several approaches can be employed:

  • Site-Directed Mutagenesis:

    • Target conserved residues identified through sequence alignment with other CYP71 family enzymes

    • Focus on regions corresponding to substrate recognition sites (SRS) in cytochrome P450s

    • Evaluate effects on either dehydration or hydroxylation activities separately

  • Domain Swapping Experiments:

    • Create chimeric enzymes with other CYP71 family members (e.g., CYP71AM1 from sorgoleone pathway )

    • Identify domains responsible for substrate specificity and catalytic function

    • Example approach: Compare with CYP71AM1, which catalyzes the formation of dihydrosorgoleone using 5-pentadecatrienyl resorcinol-3-methyl ether as substrate

  • Heterologous Expression Systems for Functional Analysis:

    • Express CYP71E1 in systems that support different aspects of its activity

    • In E. coli, flavodoxin/flavodoxin reductase only supports the dehydration reaction

    • Compare with expression in yeast or plant systems that support full activity

  • In vitro Reconstitution Studies:

    • Vary reaction conditions (pH, temperature, cofactor concentration)

    • Determine if conditions can be optimized to favor one activity over the other

    • Evaluate the effects of different redox partners on specific catalytic activities

  • Crystallography and Molecular Modeling:

    • Determine the three-dimensional structure of CYP71E1

    • Dock substrates and intermediates to identify binding modes

    • Predict conformational changes between reaction steps

How does CYP71E1 activity change during sorghum development and in response to environmental factors?

The expression and activity of CYP71E1 are developmentally regulated and responsive to environmental conditions:

  • Developmental Regulation:

    • CYP71E1 activity peaks around day 2 after germination in sorghum seedlings, coinciding with maximum cyanide potential

    • The enzyme activity (per mg of plant material) increases until day 2 and subsequently declines

    • This pattern matches the expression levels of CYP71E1 mRNA, suggesting transcriptional regulation

  • Coordinate Regulation with CYP79A1:

    • CYP71E1 and CYP79A1 show similar expression patterns during seedling development

    • The activity of CYP71E1 is always higher than the combined activity of the enzymes, ensuring that CYP79A1 remains the rate-limiting step

    • This coordination prevents accumulation of toxic intermediates in the pathway

  • Response to Mineral Salts:

    • In young seedlings (up to 8 days old), growth in the presence of different mineral salts does not increase cyanide potential

    • In older plants (5 weeks), nitrogen treatment increases biosynthetic activity and dhurrin content

    • Treatment with KNO₃ increases CYP79A1 mRNA levels and biosynthetic activity in older plants

For accurate developmental studies, researchers should consider:

  • The specific tissue being analyzed (root, stem, leaf)

  • The age of the plants

  • Growth conditions including light, temperature, and nutrient status

  • Methods sensitive enough to detect low levels of activity in older plants

What approaches are effective for engineering CYP71E1 to modify its substrate specificity or product profile?

Engineering CYP71E1 for altered functionality can be approached through several strategies:

  • Rational Design Based on Sequence Comparisons:

    • Align CYP71E1 with related enzymes that have different substrate preferences

    • Target substrate recognition sites (SRS regions) known to influence specificity in P450s

    • Example: Compare with CYP71AM1 which acts on 5-pentadecatrienyl resorcinol-3-methyl ether

  • Directed Evolution:

    • Generate libraries of CYP71E1 variants through random mutagenesis

    • Screen for desired activities using high-throughput assays

    • Combine beneficial mutations through DNA shuffling

  • Metabolic Engineering Approaches:

    • Express engineered CYP71E1 variants alongside other pathway enzymes

    • Test ability to produce novel cyanogenic compounds

    • Co-express with different glycosyltransferases to modify product profiles

  • Substrate Analogs Testing:

    • Synthesize structural analogs of p-hydroxyphenylacetaldehyde oxime

    • Identify modifications that are tolerated by the enzyme

    • Develop structure-activity relationships to guide engineering efforts

  • Protein Fusion Strategies:

    • Create fusion proteins with redox partners to enhance electron transfer

    • Develop self-sufficient P450 systems by fusion with reductase domains

    • Improve stability and activity in heterologous hosts

Lessons can be drawn from successful engineering of other plant P450s and applied to CYP71E1, considering its dual catalytic function and role in a metabolic channel with CYP79A1.

What are the critical controls needed when studying recombinant CYP71E1 activity?

When designing experiments with recombinant CYP71E1, the following controls are essential:

  • Enzyme Activity Controls:

    • No-enzyme control to account for non-enzymatic conversion

    • Heat-inactivated enzyme control to confirm enzymatic nature of the reaction

    • Known P450 inhibitor controls (e.g., carbon monoxide, which inhibits cytochrome P450 and is reversed by 450 nm light)

    • NADPH dependence control (omit NADPH from reaction mixture)

    • Oxygen dependence control (perform reaction under nitrogen atmosphere)

  • Substrate Specificity Controls:

    • Test structurally related compounds that are not natural substrates

    • Include both E- and Z-isomers of p-hydroxyphenylacetaldehyde oxime

    • Test substrate analogs with modifications that should prevent catalysis

  • Expression System-Specific Controls:

    • Empty vector control (host expressing vector without CYP71E1 insert)

    • Control for host endogenous P450 activities

    • When using plant expression systems, consider control for endogenous dhurrin pathway enzymes

  • Antibody-Based Controls:

    • Pre-immune serum control for antibody specificity

    • Monospecific polyclonal antibodies against NADPH-cytochrome P450-reductase can be used to confirm dependence on this redox partner

  • Pathway Reconstitution Controls:

    • When reconstituting the pathway with both CYP79A1 and CYP71E1, include single enzyme controls

    • Test for metabolic channeling by comparing direct addition of intermediate vs. production by upstream enzyme

How can RNA interference techniques be applied to study CYP71E1 function in planta?

RNA interference (RNAi) provides a powerful approach to investigate CYP71E1 function in Sorghum bicolor:

  • Design Strategy:

    • Target unique regions of CYP71E1 mRNA to avoid off-target effects on related P450s

    • Create hairpin constructs with CYP71E1-specific sequences

    • Use appropriate promoters (constitutive or tissue-specific)

  • Vector Construction and Transformation:

    • Similar to the approach used for CYP71AM1 in sorgoleone biosynthesis

    • Use Agrobacterium-mediated transformation of Sorghum bicolor

    • Generate multiple independent transformant events to account for position effects

  • Phenotypic Analysis:

    • Measure dhurrin content in various tissues using colorimetric or analytical methods

    • Quantify potential accumulation of pathway intermediates

    • Assess plant development, stress tolerance, and herbivore resistance

  • Molecular Characterization:

    • Confirm knockdown efficiency using RT-qPCR

    • Measure expression levels of other pathway genes (CYP79A1, UGT85B1) to detect compensatory responses

    • Perform metabolomic analysis to identify broader metabolic effects

  • Experimental Controls:

    • Empty vector transformants

    • Transformants expressing RNAi constructs targeting non-plant genes (e.g., GFP)

    • Wild-type plants grown under identical conditions

An RNAi approach targeting CYP71AM1 in sorgoleone biosynthesis resulted in dramatically reduced levels of the target compound in multiple independent transformant events , suggesting this would be an effective strategy for studying CYP71E1 function in dhurrin biosynthesis.

What techniques can be used to study the interaction between CYP71E1 and CYP79A1 in the dhurrin biosynthetic pathway?

The interaction between CYP71E1 and CYP79A1 involves metabolic channeling and possibly physical association. Several techniques can investigate this relationship:

  • Co-Immunoprecipitation (Co-IP):

    • Use antibodies against one enzyme to precipitate potential protein complexes

    • Analyze precipitated proteins for presence of the partner enzyme

    • Test under different plant developmental stages or stress conditions

  • Bimolecular Fluorescence Complementation (BiFC):

    • Express CYP71E1 and CYP79A1 fused to complementary fragments of a fluorescent protein

    • Visualize interaction through reconstituted fluorescence in planta

    • Examine subcellular localization of the interaction

  • Förster Resonance Energy Transfer (FRET):

    • Tag CYP71E1 and CYP79A1 with appropriate fluorophore pairs

    • Measure energy transfer indicating close proximity of the proteins

    • Perform in native membrane environments when possible

  • Metabolic Flux Analysis:

    • Feed labeled tyrosine to systems expressing individual enzymes or both

    • Compare conversion rates and intermediate accumulation

    • Test effects of varying enzyme ratios on pathway efficiency

  • Membrane Reconstitution Studies:

    • Reconstitute purified enzymes in artificial membrane systems

    • Vary lipid composition to assess effects on enzyme association and activity

    • Compare kinetics with co-reconstituted enzymes versus separately reconstituted enzymes

  • Chemical Cross-linking:

    • Use bifunctional cross-linking reagents to capture transient interactions

    • Identify cross-linked products by mass spectrometry

    • Map interaction domains through targeted cross-linking

These techniques can provide insights into whether the metabolic channeling observed between CYP71E1 and CYP79A1 involves direct protein-protein interactions or is mediated through membrane organization.

How does CYP71E1 compare structurally and functionally to other CYP71 family enzymes in Sorghum bicolor?

Sorghum bicolor expresses multiple CYP71 family enzymes with diverse functions:

EnzymePrimary FunctionSubstratesProductsExpression PatternKey Structural Features
CYP71E1Dhurrin biosynthesisp-hydroxyphenylacetaldehyde oximep-hydroxymandelonitrilePeaks in early seedling development Multifunctional (dehydration and hydroxylation activities)
CYP71AM1Sorgoleone biosynthesis5-pentadecatrienyl resorcinol-3-methyl etherDihydrosorgoleonePredominantly in root hair cells Catalyzes dihydroxylation of a resorcinol ring structure
CYP71AF1Unknown functionIdentified in root hair cells UnknownExpressed in root hair cells Unknown specific function

Both CYP71E1 and CYP71AM1 are involved in the biosynthesis of allelochemicals in Sorghum bicolor, but they operate on different substrates and produce different products. CYP71E1 is part of the cyanogenic glucoside pathway, while CYP71AM1 contributes to the biosynthesis of the benzoquinone sorgoleone.

The catalytic versatility of CYP71 family enzymes in Sorghum is notable - CYP71E1 performs sequential dehydration and hydroxylation reactions, while CYP71AM1 catalyzes the dihydroxylation of a resorcinol ring. Both enzymes have been functionally characterized through recombinant expression and in planta studies.

What are the experimental challenges specific to working with recombinant CYP71E1 compared to other plant P450 enzymes?

Working with recombinant CYP71E1 presents several unique challenges:

  • Dual Catalytic Activity:

    • Unlike most P450s that catalyze a single reaction, CYP71E1 performs sequential dehydration and hydroxylation reactions

    • This complicates kinetic analysis and requires methods to detect both steps

    • The reaction mechanism may involve conformational changes between steps

  • Substrate Isomerism:

    • Handling the E/Z isomerism of p-hydroxyphenylacetaldehyde oxime adds complexity

    • Pure isomers are difficult to maintain due to spontaneous isomerization

    • The enzyme shows preference for the E-isomer but converts it to the Z-form during catalysis

  • Membrane Protein Expression:

    • As a membrane-bound P450, heterologous expression can result in misfolding

    • Different expression systems support different aspects of activity (e.g., E. coli supports only the dehydration reaction)

    • Requires reconstitution with appropriate lipids and redox partners

  • Metabolic Channeling:

    • In planta, CYP71E1 functions in a metabolic channel with CYP79A1

    • Reconstituting this channel in vitro is challenging but necessary for understanding native function

    • Intermediates may not accumulate due to efficient channeling, complicating detection

  • Enzyme Stability:

    • Plant P450s can be unstable when removed from their native membrane environment

    • CYP71E1's stability may be affected by the presence/absence of substrate or redox partner

    • Purification protocols need to maintain the heme in the proper oxidation state

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.