Recombinant Sorghum bicolor Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Sorghum bicolor (Sorghum) (Sorghum vulgare)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQV LANGKKGGLNVGAVLILPEGFELAPPDRISPELKEKIGNLSFQSYRPNKKNILVIGPVPG KKYSEIVFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSTGIVK KILRKEKGGYEISIVDASDGRQVIDIIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFFASVILAQVFLVLKKKQFEKVQLYEMNF
Uniprot No.

Target Background

Function
Recombinant Sorghum bicolor Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links

KEGG: sbi:4549172

Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and what is its role in Sorghum bicolor?

Apocytochrome f is a protein component of the cytochrome b6f complex encoded by the petA gene in the chloroplast genome of Sorghum bicolor. It plays a crucial role in the photosynthetic electron transport chain, facilitating electron transfer between photosystem II and photosystem I. The mature protein functions as a c-type cytochrome with a covalently bound heme group. The amino acid sequence includes a characteristic CXXCH motif (visible as "CANCHLA" in the protein sequence) that is essential for heme binding . In Sorghum bicolor, as in other plants, Apocytochrome f is essential for efficient photosynthesis and consequently affects plant growth and development.

What are the optimal storage conditions for recombinant Apocytochrome f?

Recombinant Sorghum bicolor Apocytochrome f should be stored in a Tris-based buffer with 50% glycerol at -20°C. For extended storage, the protein should be conserved at -20°C or -80°C . Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity. Working aliquots can be stored at 4°C for up to one week . These storage conditions have been optimized to maintain protein stability and functional integrity.

How can I verify the purity and integrity of recombinant Apocytochrome f?

The purity and integrity of recombinant Apocytochrome f can be assessed using several complementary analytical techniques:

Analytical MethodInformation ObtainedTechnical RequirementsAdvantages
SDS-PAGEPurity and molecular weightElectrophoresis equipmentSimple, widely accessible
Western blottingProtein identity confirmationAntibodies, transfer apparatusHigh specificity
UV-Visible spectroscopyHeme incorporationSpectrophotometerNon-destructive, fast
Mass spectrometryExact mass, sequence verificationMS instrumentHigh accuracy
Circular dichroismSecondary structureCD spectrometerAssesses protein folding

For recombinant Apocytochrome f, the appearance of characteristic absorption peaks in the visible spectrum (especially around 550-560 nm in the reduced state) would confirm proper heme incorporation and folding.

What are the recommended expression systems for recombinant Sorghum bicolor Apocytochrome f?

Several expression systems can be employed for recombinant Apocytochrome f production, each with distinct advantages:

Expression SystemAdvantagesConsiderationsTypical Yield
E. coliHigh yield, cost-effectiveMay require optimization for heme incorporation5-20 mg/L
Yeast (P. pastoris)Post-translational modificationsLonger expression time2-10 mg/L
Insect cellsBetter folding for complex proteinsMore expensive1-5 mg/L
Plant-based systemsNative-like environmentLower yield0.5-2 mg/L

For bacterial expression, similar approaches to those used for other recombinant proteins can be applied . The petA gene sequence should be optimized for codon usage in the chosen expression system, cloned into an appropriate expression vector, and transformed into a suitable strain. For E. coli expression, co-expression with a cytochrome c maturation system may be necessary for proper heme incorporation.

What purification strategy is most effective for recombinant Apocytochrome f?

A multi-step purification strategy is recommended:

  • Initial extraction: Cell lysis by sonication or French press in a buffer containing appropriate detergents to solubilize the membrane-associated protein

  • Primary separation: Immobilized metal affinity chromatography (IMAC) if a His-tag is incorporated into the recombinant protein

  • Intermediate purification: Ion exchange chromatography (typically anion exchange)

  • Polishing step: Size exclusion chromatography for final purification and buffer exchange

  • Quality control: Assessment of purity by SDS-PAGE and functionality by spectroscopic methods

This approach is similar to purification strategies employed for other recombinant proteins from Sorghum bicolor and can be optimized based on the specific construct design and expression system used.

How can I design experiments to study electron transfer kinetics of Apocytochrome f?

Electron transfer kinetics studies require specialized techniques:

  • Sample preparation: Purified recombinant Apocytochrome f must be in a defined redox state (typically fully oxidized or reduced)

  • Experimental approaches:

    • Stopped-flow spectroscopy: Mix Apocytochrome f with electron donors/acceptors and monitor absorbance changes

    • Flash photolysis: Use light pulses to initiate electron transfer and follow spectral changes

    • Electrochemical methods: Direct measurement of electron transfer to electrodes

  • Data analysis:

    • Fit kinetic traces to appropriate models (single or multiple exponential decays)

    • Extract rate constants and compare with theoretical predictions

    • Analyze temperature dependence to determine activation parameters

  • Controls and validations:

    • Compare with known electron transfer proteins

    • Test the effects of conditions (pH, ionic strength, temperature)

    • Validate using site-directed mutants with altered electron transfer properties

This approach draws on methodology similar to that used for studying other electron transfer proteins in photosynthetic organisms.

How does Sorghum bicolor Apocytochrome f compare to homologous proteins in other species?

Comparative analysis reveals important insights about evolutionary adaptation:

Plant SpeciesSequence Identity to S. bicolor (%)Notable FeaturesFunctional Implications
Zea mays (maize)~95Highly conserved (C4 plant)Similar function, adaptation to C4 photosynthesis
Arabidopsis thaliana~85Key differences in surface residuesAdaptation to different ecological niches
Spinacia oleracea (spinach)~80Well-characterized structureModel system for cytochrome f research
Chlamydomonas reinhardtii~65More divergent sequenceAdaptation to aquatic environment

Sequence alignment and structural comparison allow identification of conserved functional domains versus variable regions that may reflect adaptive evolution. This comparative approach can reveal how structural variations translate into functional differences in different plant species.

What approaches can be used to study the interaction of Apocytochrome f with other components of the photosynthetic electron transport chain?

Multiple complementary techniques can characterize protein-protein interactions:

  • In vitro binding assays:

    • Surface plasmon resonance (SPR): Quantitative measurement of binding kinetics and affinity

    • Isothermal titration calorimetry (ITC): Thermodynamic parameters of binding

    • Microscale thermophoresis (MST): Binding under near-native conditions

  • Structural approaches:

    • Chemical cross-linking coupled with mass spectrometry: Identification of interaction interfaces

    • Co-crystallization: Direct visualization of protein complexes

    • NMR spectroscopy: Dynamic aspects of protein interactions

  • Functional assays:

    • Reconstitution experiments: Combining purified components to measure electron transfer rates

    • Mutational analysis: Testing the effects of targeted mutations on binding and electron transfer

This methodological framework enables comprehensive characterization of the interactions between Apocytochrome f and its physiological partners, particularly plastocyanin or cytochrome c6.

How can site-directed mutagenesis be used to study structure-function relationships in Apocytochrome f?

Site-directed mutagenesis provides powerful insights into structure-function relationships:

  • Target selection:

    • Conserved residues identified through sequence alignment

    • Residues near the heme group

    • Surface residues potentially involved in protein interactions

    • Residues with unusual physical/chemical properties

  • Mutation design:

    • Conservative substitutions (e.g., Asp to Glu) to test specific properties

    • Non-conservative substitutions to test functional importance

    • Alanine scanning to assess residue contributions

    • Introduction of spectroscopic probes at specific positions

  • Functional analysis of mutants:

    • Redox potential measurements

    • Electron transfer kinetics

    • Binding affinity for interaction partners

    • Structural stability and integrity

This approach is analogous to methods used for studying other cytochromes and electron transfer proteins, allowing systematic mapping of functional regions.

How can recombinant Apocytochrome f be utilized in biosensor development?

Recombinant Apocytochrome f has potential applications in biosensor technology:

  • Electrochemical biosensors:

    • Immobilization on electrode surfaces for direct electron transfer

    • Integration into detection systems for herbicides that target photosynthesis

    • Environmental monitoring for pollutants affecting electron transport

  • Methodological approaches:

    • Protein engineering to enhance stability on surfaces

    • Optimization of immobilization strategies (covalent attachment, entrapment in matrices)

    • Signal amplification through coupling with reporting systems

    • Calibration using known inhibitors or electron transfer mediators

  • Performance evaluation:

    • Sensitivity and detection limits

    • Selectivity and interference testing

    • Stability under various environmental conditions

    • Response time and reproducibility

These applications leverage the electron transfer capabilities of Apocytochrome f in devices designed for specific analytical purposes.

What challenges exist in crystallizing recombinant Apocytochrome f for structural studies?

Crystallization of Apocytochrome f presents several technical challenges:

  • Inherent protein properties:

    • Membrane-associated nature complicates solubilization

    • Flexibility of certain regions may prevent crystal formation

    • Proper heme incorporation is essential for native structure

  • Experimental strategies to overcome challenges:

    • Screening various detergents for optimal solubilization

    • Using lipidic cubic phase crystallization methods

    • Employing fusion partners or crystallization chaperones

    • Truncation of flexible regions to improve crystal packing

    • Surface entropy reduction through targeted mutations

  • Alternative structural approaches:

    • Cryo-electron microscopy for membrane protein complexes

    • NMR spectroscopy for dynamic regions

    • Computational modeling based on homologous structures

Successful crystallization would provide valuable insights into the specific structural features of Sorghum bicolor Apocytochrome f compared to other plant species.

How can recombinant antibodies be used to study Apocytochrome f function?

Recombinant antibodies offer specific advantages over traditional animal-derived antibodies for studying Apocytochrome f:

  • Generation approaches:

    • Phage display selection against purified Apocytochrome f

    • Synthetic antibody libraries screened for specific binding

    • Rational design based on structural information

  • Applications:

    • Immunoprecipitation to isolate native protein complexes

    • Immunolocalization to study subcellular distribution

    • Modulation of protein function (inhibitory or activating antibodies)

    • Structural studies through antibody-mediated crystallization

  • Advantages over animal-derived antibodies:

    • Defined specificity and reproducibility

    • Possibility of engineering for specific properties

    • Ethical considerations (no animal use)

    • Consistent supply without batch variation

Recombinant antibodies represent a methodologically superior alternative to animal-based antibody production methods , providing valuable tools for studying Apocytochrome f structure and function.

How can Apocytochrome f research contribute to understanding adaptation mechanisms in Sorghum?

Research on Apocytochrome f can be integrated with broader studies on Sorghum adaptation:

  • Connection to genomic studies:

    • Analysis of petA gene variation in different Sorghum varieties

    • Correlation with adaptation to different environmental conditions

    • Integration with whole-genome adaptation studies

  • Physiological context:

    • Relationship between Apocytochrome f properties and photosynthetic efficiency

    • Adaptation to different light conditions and temperatures

    • Response to drought or other stresses common in Sorghum cultivation

  • Methodological integration:

    • Combining protein-level studies with genomic approaches

    • Correlation of sequence variations with functional properties

    • Development of markers for breeding programs based on functional variations

This integrated approach connects molecular-level studies of Apocytochrome f with broader research on adaptation mechanisms in Sorghum, potentially contributing to crop improvement strategies.

What are the current limitations in our understanding of Sorghum bicolor Apocytochrome f?

Despite advances, several knowledge gaps remain:

  • Structural information:

    • Lack of high-resolution structure specific to Sorghum bicolor Apocytochrome f

    • Limited understanding of species-specific structural features

    • Incomplete characterization of post-translational modifications

  • Functional aspects:

    • Precise electron transfer pathways in the context of C4 photosynthesis

    • Regulatory mechanisms affecting protein expression and turnover

    • Adaptation mechanisms to environmental stresses

  • Methodological challenges:

    • Difficulty in expressing fully functional protein in heterologous systems

    • Challenges in studying membrane protein interactions in native-like environments

    • Limited tools for in vivo studies of electron transfer

Addressing these limitations requires interdisciplinary approaches combining structural biology, biochemistry, and plant physiology techniques.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.