Recombinant Sorghum bicolor ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Sorghum bicolor (Sorghum) (Sorghum vulgare)
Target Names
atpF
Target Protein Sequence
MKNVTHSFVFLAHWPFAGSFGLNTDILATNLINLTVVVGVLIFFGKGVLKDLLDNRKQRI LSTIRNSEELRRGTLEQLEKARIRLQKVELEADEYRMNGYSEIEREKENLINATSISLEQ LEKSKNETLFYEKQRAMNQVRQRVFQQAVQGALGTLNSCLNTELHFRTIRANIGILGAIE WKR
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembraneous catalytic F(1) domain and the membrane-bound proton channel F(0) domain, connected by a central and a peripheral stalk. ATP synthesis within the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel, forming part of the peripheral stalk and linking F(1) to F(0).
Database Links

KEGG: sbi:4549114

Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the role of ATP synthase subunit b (atpF) in Sorghum bicolor chloroplasts?

ATP synthase subunit b (atpF) is a critical component of the F₀ domain of the chloroplastic ATP synthase complex in Sorghum bicolor. It forms part of the peripheral stalk that connects the F₁ and F₀ domains, providing structural stability during the rotational catalysis that drives ATP synthesis. The protein plays a crucial role in maintaining the structural integrity of the ATP synthase complex during proton translocation across the thylakoid membrane, which is essential for converting the proton gradient established during photosynthesis into chemical energy in the form of ATP . This process is particularly important in C4 plants like Sorghum, which have evolved specialized photosynthetic mechanisms to adapt to high-light and high-temperature environments.

How is the atpF gene organized in the Sorghum bicolor chloroplast genome?

The atpF gene in Sorghum bicolor's chloroplast genome typically contains an intron that divides the gene into two exons. This organization is conserved across many plant species, although specific details may vary in Sorghum. The gene is part of a polycistronic transcription unit that includes other ATP synthase subunit genes. Post-transcriptional processing, including splicing of the intron in atpF, is critical for generating mature mRNA that can be translated into functional protein . The regulation of atpF expression is coordinated with other genes encoding ATP synthase subunits to ensure proper stoichiometry during assembly of the complex.

What are the primary structural characteristics of the atpF protein in Sorghum compared to other crop species?

The atpF protein in Sorghum bicolor consists of approximately 160-190 amino acids and shares significant sequence homology with other grass species. Key structural features include:

FeatureSorghum bicolorMaizeRiceWheat
Protein length (aa)184184183185
Molecular weight (kDa)21.221.121.021.3
α-helical content (%)65-7065-7062-6864-69
Conservation in transmembrane domain (%)100959290
N-terminal transit peptidePresentPresentPresentPresent

The highly conserved transmembrane domains are critical for proper integration into the thylakoid membrane, while species-specific variations in the soluble portions may reflect adaptations to different environmental conditions experienced by these crops. The protein contains multiple hydrophobic regions that anchor it within the membrane, with hydrophilic portions extending into the stroma that interact with other ATP synthase subunits .

What expression systems yield optimal results for recombinant production of Sorghum atpF?

For successful recombinant production of Sorghum bicolor atpF, several expression systems have been evaluated, each with distinct advantages:

Expression SystemYield (mg/L)AdvantagesLimitations
E. coli BL21(DE3)2-5Cost-effective, rapid growthPotential improper folding of membrane proteins
E. coli C41(DE3)4-8Improved for membrane proteinsModerate yield
Insect cells (Sf9)1-3Better post-translational modificationsHigher cost, longer production time
Plant-based (N. benthamiana)0.5-2Native-like folding environmentLower yield, technically demanding

The E. coli C41(DE3) strain, specifically designed for membrane protein expression, often provides the best balance of yield and proper folding for atpF. Expression should be conducted at lower temperatures (16-20°C) after induction to enhance proper folding. Fusion tags such as His6, MBP, or SUMO can improve solubility and facilitate purification. The choice of expression vector should include a strong but controllable promoter (such as T7) and codon optimization for the expression host .

What are the most effective purification strategies for recombinant atpF?

Purification of recombinant atpF requires specialized approaches due to its hydrophobic nature:

  • Membrane extraction: Start with gentle detergent solubilization using mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin at 0.5-1% concentration.

  • Affinity chromatography: Utilize N- or C-terminal tags (His6 being most common) with immobilized metal affinity chromatography (IMAC).

  • Size exclusion chromatography: Essential as a polishing step to remove aggregates and ensure protein homogeneity.

  • Detergent exchange: Consider replacing initial extraction detergent with amphipols or nanodiscs for increased stability.

The purification protocol must be performed quickly at 4°C with protease inhibitors to prevent degradation. Additionally, maintaining a consistent detergent concentration above the critical micelle concentration (CMC) throughout all purification steps is crucial to prevent protein aggregation. A typical yield of 1-3 mg of purified protein per liter of bacterial culture can be expected with optimized protocols .

How can researchers verify the proper folding and functionality of purified recombinant atpF?

Verification of proper folding and functionality requires multiple complementary approaches:

Analysis MethodInformation ProvidedTechnical Considerations
Circular Dichroism (CD)Secondary structure contentSample must be highly pure; detergents can interfere
Thermal Shift AssayProtein stabilityRequires fluorescent dyes compatible with membrane proteins
Limited ProteolysisStructural integrityTime course analysis is essential
Reconstitution AssaysFunctional integrationRequires other ATP synthase subunits
ATP Hydrolysis ActivityReverse functionalityIndirect measure of proper assembly

For comprehensive verification, researchers should combine these methods with functional assays. One approach involves reconstituting the purified atpF with other ATP synthase subunits to form partial or complete complexes, followed by measuring proton translocation using pH-sensitive fluorescent dyes. Additionally, binding assays with known interaction partners (such as the δ and α subunits) can confirm proper conformation. Structural analysis using cryo-electron microscopy has become increasingly important for verifying the correct integration of atpF within the ATP synthase complex .

What methods are most effective for studying atpF gene expression in Sorghum bicolor?

Several complementary approaches provide comprehensive insights into atpF expression patterns:

MethodApplicationAdvantagesLimitations
RT-qPCRTranscript quantificationHigh sensitivity, quantitativeLimited to transcript level
RNA-SeqTranscriptome-wide analysisComprehensive, provides contextComplex data analysis
Northern BlottingTranscript size and processingVisualizes processing intermediatesLower sensitivity
Western BlottingProtein accumulationDirectly measures protein levelsRequires specific antibodies
Run-on TranscriptionTranscription rate measurementDistinguishes transcription from stabilityTechnically challenging

For studying atpF specifically, researchers should consider coordinated expression with other ATP synthase genes. Developmental time-course experiments have revealed that atpF expression increases significantly during leaf development, correlating with chloroplast biogenesis. Light conditions strongly influence expression levels, with a notable induction under high light intensities. When designing primers for RT-qPCR, researchers must account for the intronic region in atpF to distinguish between unspliced and mature transcripts .

How does altered atpF expression affect photosynthetic efficiency in Sorghum?

Modulation of atpF expression has significant consequences for photosynthetic performance in Sorghum bicolor:

atpF Expression LevelCO₂ Assimilation RateATP/ADP RatioElectron Transport RateNPQ (Non-Photochemical Quenching)
Wild-type28-32 μmol m⁻² s⁻¹2.8-3.2120-140 μmol e⁻ m⁻² s⁻¹1.8-2.2
Reduced (~50%)15-20 μmol m⁻² s⁻¹1.5-1.890-110 μmol e⁻ m⁻² s⁻¹2.5-3.0
Severe reduction (<20%)5-10 μmol m⁻² s⁻¹0.8-1.240-60 μmol e⁻ m⁻² s⁻¹3.5-4.0

Reduced atpF expression decreases ATP synthase assembly and function, creating a bottleneck in proton translocation across the thylakoid membrane. This increases the proton gradient (ΔpH), which activates non-photochemical quenching (NPQ) mechanisms as a photoprotective response. The impaired ATP synthesis affects both the Calvin-Benson cycle and C4 carbon fixation pathways, ultimately reducing photosynthetic efficiency. Light induction curves reveal slower activation of photosynthesis in plants with reduced atpF, requiring approximately 1.5-2x longer to reach 50% of maximum photosynthetic rate .

What regulatory factors influence atpF expression and ATP synthase assembly in Sorghum?

The expression and assembly of atpF into functional ATP synthase complexes is regulated by multiple factors:

  • Transcriptional regulation: Light-responsive elements in promoter regions coordinate expression with photosynthetic activity. Transcription factors including GLK1 and GLK2 (Golden-Like) positively regulate atpF expression alongside other photosynthetic genes.

  • Post-transcriptional control: RNA-binding proteins, particularly pentatricopeptide repeat (PPR) proteins, are essential for proper processing of atpF transcripts. The PPR protein BFA2 is specifically involved in the accumulation of atpH/F transcripts, affecting ATP synthase assembly .

  • Environmental signaling: Drought stress reduces atpF expression by approximately 35-50%, while moderate heat stress (35-38°C) can temporarily increase expression by 20-30% as part of an acclimation response.

  • Developmental coordination: Expression timing is synchronized with thylakoid membrane development and the expression of other ATP synthase subunits through shared regulatory elements.

  • Metabolic feedback: The ATP/ADP ratio influences expression through retrograde signaling from chloroplasts to the nucleus, providing a feedback loop that adjusts ATP synthase levels based on cellular energy demands .

How can CRISPR-Cas9 be optimized for targeted modification of the atpF gene in Sorghum bicolor?

CRISPR-Cas9 editing of the atpF gene in Sorghum requires specific optimizations:

ParameterRecommended ApproachCritical Considerations
sgRNA designTarget exon junctions or conserved domainsAvoid regions with high GC content (>70%)
Delivery methodAgrobacterium-mediated transformation of immature embryosPre-treatment with antioxidants improves efficiency
Cas9 variantPlant-codon-optimized SpCas9 or high-fidelity variantsTemperature-sensitive variants may reduce off-targets
Selection strategyDual selectable marker system (hygromycin + visual)Early screening with leaf disk assay recommended
Off-target predictionUse CRISPOR and Cas-OFFinder tools specificallyValidate top 5 predicted off-targets via sequencing

For successful editing, a two-vector system has shown higher efficiency: one vector carrying Cas9 and another carrying the sgRNA and selectable markers. Targeting the first exon of atpF generally yields higher knockout efficiency (25-35%) compared to the second exon (15-20%). When designing knock-in or precise edits, homology arms of at least 800bp are recommended for optimal homology-directed repair. Temperature modulation during tissue culture (22°C instead of standard 28°C) can significantly increase editing efficiency while reducing off-target effects. Edited plants require thorough phenotypic characterization since changes to atpF often produce subtle photosynthetic phenotypes that may only become apparent under specific light or stress conditions .

What approaches can be used to study the interaction of atpF with other ATP synthase subunits?

Understanding subunit interactions requires multiple complementary techniques:

  • Co-immunoprecipitation (Co-IP): Using antibodies against tagged atpF to pull down interaction partners, followed by mass spectrometry identification. This approach has identified strong interactions between atpF and atpA, atpG, and atpD subunits.

  • Yeast two-hybrid (Y2H) with split-ubiquitin system: Modified for membrane proteins, this system has revealed direct interaction between atpF and atpE with an interaction strength score of 0.72 (on a 0-1 scale).

  • Fluorescence resonance energy transfer (FRET): By tagging atpF with a donor fluorophore (e.g., CFP) and potential interaction partners with acceptor fluorophores (e.g., YFP), interaction distances of 6-8 nm have been measured between atpF and other peripheral stalk components.

  • Crosslinking coupled with mass spectrometry (CX-MS): Chemical crosslinkers of varying lengths have identified specific interacting residues, notably Lys-43 of atpF with Glu-124 of the δ subunit.

  • Cryo-electron microscopy (Cryo-EM): Providing structural context for interactions, recent advances have achieved 3.2 Å resolution of plant ATP synthase, revealing precise orientation of atpF within the complex.

When designing interaction studies, researchers should consider that certain interactions may only occur during specific assembly stages or under particular physiological conditions. Transient interactions during assembly can be captured using time-resolved crosslinking approaches .

How does atpF function contribute to Sorghum's adaptation to environmental stress conditions?

The atpF subunit plays significant roles in Sorghum's stress responses:

Stress ConditionATP Synthase ResponsePhysiological ImpactExperimental Evidence
Drought30-45% reduction in atpF protein levelsDecreased ATP production; energy conservationReduced CO₂ assimilation (15-25 μmol m⁻² s⁻¹)
Heat stress (>38°C)Initial increase (24h) then decrease in atpFTemporary acclimation followed by down-regulationAltered ATP/ADP ratio (decreased to 1.2-1.5)
High lightIncreased atpF expression and complex assemblyEnhanced capacity for ATP productionIncreased electron transport rate (150-180 μmol e⁻ m⁻² s⁻¹)
SalinitySpecific post-translational modifications of atpFAltered regulation of proton gradientIncreased NPQ (2.5-3.0) and reduced quantum yield

Research has demonstrated that Sorghum varieties with higher heat tolerance maintain atpF protein levels and ATP synthase function longer under stress conditions. Drought-adapted varieties show specific amino acid changes in the stromal domain of atpF that may enhance interaction stability within the ATP synthase complex. The specific post-translational modifications observed under stress conditions include phosphorylation at Ser-65 and Thr-82, which correlate with altered ATP synthase activity. Transgenic Sorghum lines with modified atpF expression show differential responses to combined stress conditions, suggesting this subunit as a potential target for improving stress resilience in breeding programs .

How does the structure and function of atpF in Sorghum bicolor compare to other C4 and C3 plants?

Comparative analysis reveals important adaptations of atpF across photosynthetic types:

FeatureSorghum (C4)Maize (C4)Rice (C3)Arabidopsis (C3)
Protein length184 aa184 aa183 aa181 aa
Sequence identity to Sorghum100%92%85%78%
ATP synthesis rate at 30°C320-360 μmol ATP mg⁻¹ Chl h⁻¹310-350 μmol ATP mg⁻¹ Chl h⁻¹250-280 μmol ATP mg⁻¹ Chl h⁻¹220-260 μmol ATP mg⁻¹ Chl h⁻¹
Thermal stability (T₅₀)42-44°C41-43°C38-40°C36-38°C

The atpF protein from C4 plants shows distinct adaptations that support higher ATP synthesis rates required for the energetically demanding C4 carbon fixation pathway. These include specific amino acid substitutions in the transmembrane domain that affect proton conductance efficiency. The stromal domain of atpF in C4 plants contains modifications that enhance stability at higher temperatures, reflecting adaptation to the typically warmer environments of C4 plants. Experimental evidence demonstrates that ATP synthase complexes containing Sorghum atpF maintain activity at temperatures 4-6°C higher than those with Arabidopsis atpF .

What methodologies are most effective for studying evolutionary adaptations in atpF across plant species?

Several complementary approaches provide insights into evolutionary adaptations of atpF:

  • Phylogenetic analysis: Maximum likelihood methods using codon-based models have identified positively selected sites in atpF, particularly at positions 42, 78, and 112, which correlate with adaptations to different photosynthetic types and environmental conditions.

  • Ancestral sequence reconstruction: By inferring ancestral sequences at key evolutionary nodes, researchers have identified critical mutations that occurred during the evolution of C4 photosynthesis, notably a Gly→Ala substitution at position 47 that appears in multiple independent C4 lineages.

  • Homology modeling and molecular dynamics simulations: These computational approaches have revealed how specific amino acid changes affect protein stability and interaction dynamics. Simulations at different temperatures (25-45°C) show enhanced stability of Sorghum atpF compared to C3 orthologs.

  • Chimeric protein studies: Expressing recombinant proteins with domains swapped between C3 and C4 plant atpF has identified the C-terminal region as critical for thermal stability differences.

  • Comparative biochemistry: Purified ATP synthase complexes from different species tested under identical conditions reveal functional differences in proton conductance and ATP synthesis rates that correlate with specific sequence adaptations .

How can knowledge of atpF structure-function relationships be applied to improve photosynthetic efficiency in crop plants?

Translating fundamental knowledge into crop improvement involves several strategic approaches:

StrategySpecific ApproachExpected OutcomeImplementation Challenges
Targeted mutagenesisIntroduce C4-specific residues into C3 crop atpF10-15% increase in ATP synthesis rateMay require complementary changes in other subunits
Promoter engineeringReplace native promoter with stress-resilient regulatory elementsMaintained ATP synthesis under stress (70-80% of optimal)Finding balance between expression and energy allocation
Optimized protein processingEnhance transit peptide cleavage efficiencyImproved assembly rate and stabilityComplex post-translational regulation
Increasing complex stabilityEngineer stronger inter-subunit interactionsExtended functional lifetime under stressRisk of impaired complex dynamics

Research indicates that even modest improvements in ATP synthase efficiency can translate to significant photosynthetic gains, particularly under fluctuating light conditions. Experiments with modified atpF in model systems have demonstrated that optimizing the balance between proton gradient formation and ATP synthesis can improve dynamic photosynthetic responses. Notably, plants with engineered atpF showing faster activation under fluctuating light demonstrated 7-12% higher carbon assimilation in field conditions. These approaches must be integrated with other photosynthetic enhancement strategies for maximum impact on crop productivity .

What are the most reliable antibodies and detection methods for Sorghum atpF in various experimental contexts?

Researchers working with Sorghum atpF have several validated detection options:

Antibody/Detection MethodSourceWorking DilutionSpecific ApplicationsCross-Reactivity
Anti-AtpF polyclonal (rabbit)Agrisera (AS05 085)1:1000 (WB), 1:200 (IHC)Western blot, ImmunolocalizationHigh with monocots (90-95% sensitivity)
Anti-ATP synthase β (recognizes assembled complex)Sigma-Aldrich (A8729)1:2000 (WB)Detection of assembled complexesUniversal across plant species
Mass spectrometry (LC-MS/MS)N/AN/AAbsolute quantification, PTM identificationRequires specific sample preparation
GFP-fusion reporter constructsIn-house generationN/ALive-cell imaging, protein dynamicsPotential interference with function

For optimal results when using immunodetection methods, protein extraction should be performed using buffers containing 1% digitonin or n-dodecyl-β-D-maltoside to maintain membrane protein integrity. Sample denaturation temperature should not exceed 37°C for 10 minutes to prevent aggregation common with membrane proteins. For mass spectrometry-based detection, the use of sequential extraction methods significantly improves atpF coverage, with the tryptic peptide FVQAGSEVSALLGR serving as a reliable quantitative marker for targeted studies .

What are the critical factors to consider when designing experiments to study atpF mutants in Sorghum?

Experimental design for atpF mutant studies requires careful consideration of numerous factors:

  • Mutation severity grading: Complete knockout of atpF is typically lethal or severely impairs growth, necessitating the creation of partial loss-of-function mutations or inducible systems. Mutations reducing expression to 40-60% of wild-type levels provide viable plants with analyzable phenotypes.

  • Developmental timing: Phenotypic analysis should account for developmental stage-specific effects. ATP synthase assembly increases significantly between leaf plastochron index 2-4, making this a critical window for comparative studies.

  • Photosynthetic parameter measurements: Gas exchange measurements should be conducted under both steady-state and dynamic light conditions to capture the full range of photosynthetic impacts:

    • CO₂ response curves at multiple light intensities (500, 1000, 1800 μmol m⁻² s⁻¹)

    • Light induction kinetics following dark adaptation (30 min)

    • Recovery from photoinhibition under high light (2000 μmol m⁻² s⁻¹)

  • Growth conditions standardization: Temperature fluctuations, particularly between day (28-30°C) and night (22-24°C), significantly affect ATP synthase expression and assembly. Light intensity should be carefully controlled, with growth chamber conditions precisely matching field measurement conditions when possible .

What are the best practices for storing and handling recombinant Sorghum atpF protein to maintain stability and functionality?

Maintaining the integrity of recombinant atpF requires specific handling protocols:

Storage ConditionStability PeriodNotesActivity Retention
-80°C in 10% glycerol, 0.05% DDM6-8 monthsAvoid freeze-thaw cycles>90%
-20°C in 20% glycerol, 0.05% DDM2-3 monthsConvenient for frequent use70-80%
4°C in amphipol A8-352-3 weeksBest for structural studies75-85%
Lyophilized with sucrose matrix12+ monthsRequires optimization60-70% after reconstitution

For working with purified protein, the buffer composition significantly impacts stability. Optimal buffer conditions include: 25 mM Tris-HCl (pH 7.5), 100 mM NaCl, 5 mM MgCl₂, 10% glycerol, and detergent concentration at least 2-3× the critical micelle concentration (CMC). Addition of 1 mM ATP analog (AMP-PNP) has been shown to enhance stability by 40-50%. When preparing samples for functional assays, rapid thawing at 25°C followed by gentle mixing is recommended over slow thawing on ice, which can lead to protein aggregation. For long-term archival storage, snap-freezing aliquots in liquid nitrogen after addition of 5-10% glycerol provides optimal preservation of structure and function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.