Recombinant Sorghum bicolor CASP-like protein Sb02g009660 (Sb02g009660)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Sb02g009660; CASP-like protein 1D1; SbCASPL1D1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Sorghum bicolor (Sorghum) (Sorghum vulgare)
Target Names
Sb02g009660
Target Protein Sequence
MATVDVDTTTESGKAAAAAAPSPPAAACRRSSFSGADLALRALLFAVTLAGLIVLATAKQ TVSIPVPEIPGLLVSRPAKFNHSPALIYLLVAQCVTCFYSLLTALTSLKLISGSSPTKTL FLLVLLDVLYAAIMASATGSAGGVAWIGLKGNTHTNWTKICNIYGNFCRHIGSSVFLGLV ASVILVLLTILNAYCLYRRSR
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structural characterization of Sorghum bicolor CASP-like protein Sb02g009660?

Sb02g009660 is a membrane-spanning protein belonging to the CASP-like (CASPL) family in Sorghum bicolor. Like other CASP proteins, it likely contains four transmembrane domains with two extracellular loops (EL1 and EL2). The protein shares conserved residues in its transmembrane domains with other members of the MARVEL protein family, particularly in TM3 where a conserved Asp residue is essential for proper protein folding . The characteristic feature of CASP-like proteins is their ability to form membrane scaffolds and potentially direct cell wall modifications, although these two functions can be uncoupled .

How can I design primers for the amplification and cloning of Sb02g009660?

Methodological approach:

  • Retrieve the complete genomic and coding sequences of Sb02g009660 from databases such as Gramene or Plant GDB

  • Analyze the gene structure using Gene Structure Display Server software to identify exons, introns, and UTRs

  • Design primers that:

    • Include restriction enzyme sites compatible with your expression vector

    • Avoid intronic regions if amplifying from genomic DNA

    • Have optimal melting temperatures (58-62°C)

    • Possess low self-complementarity and hairpin formation potential

  • For recombinant protein production, modify the forward primer to include appropriate tags (His, GST, etc.) and ensure in-frame fusion

  • Validate primer specificity using BLAST against the Sorghum bicolor genome to prevent non-specific amplification

What native expression pattern does Sb02g009660 exhibit across different tissue types?

While specific expression data for Sb02g009660 is not directly reported in the literature, studies on CASP-like proteins in Sorghum bicolor suggest tissue-specific expression patterns. Based on qRT-PCR analysis of SbPRPs and SbHyPRPs (related protein families), expression levels typically vary significantly across root, stem, and leaf tissues . For accurate determination of Sb02g009660 expression:

  • Extract total RNA from root, stem, and leaf tissues using a nucleospin plant RNA isolation kit

  • Synthesize cDNA using a first-strand synthesis kit

  • Perform qRT-PCR using SYBR Green Master Mix with gene-specific primers

  • Use appropriate reference genes (e.g., actin or GAPDH) for normalization

  • Calculate relative expression using the 2^-ΔΔCt method

  • Analyze statistical significance across biological replicates

How can I determine the subcellular localization of Sb02g009660 protein?

Methodological approach:

  • Fluorescent Protein Fusion Strategy:

    • Clone the full-length Sb02g009660 coding sequence into an expression vector with a C- or N-terminal GFP/YFP tag

    • Transform the construct into:
      a) Sorghum protoplasts for transient expression
      b) Arabidopsis as a heterologous system using Agrobacterium-mediated transformation

    • Image using confocal microscopy to detect fluorescence patterns

  • Co-localization Analysis:

    • Compare localization with known membrane domain markers

    • Based on CASP protein properties, focus on plasma membrane, particularly regions corresponding to Casparian strips in root endodermal cells

    • Use membrane-specific dyes (e.g., FM4-64) as counterstains

  • Deletion/Mutation Experiments:

    • Create variants with deleted or mutated transmembrane domains or extracellular loops

    • Assess changes in localization patterns (similar to experiments with AtCASP1)

  • Immunogold Electron Microscopy:

    • Use antibodies specific to Sb02g009660 or its epitope tag

    • Visualize at ultrastructural level the precise membrane localization

What experimental approaches can determine if Sb02g009660 forms membrane domains similar to other CASP proteins?

Based on research with other CASP proteins, the following methodological approaches are recommended:

  • Fluorescence Recovery After Photobleaching (FRAP):

    • Express Sb02g009660-GFP fusion in plant cells

    • Photobleach specific membrane regions

    • Measure fluorescence recovery rate to assess protein mobility

    • Compare with known scaffold proteins (slow recovery) and freely diffusing membrane proteins (rapid recovery)

  • Protein-Protein Interaction Analysis:

    • Perform co-immunoprecipitation to identify interacting partners

    • Use yeast two-hybrid or split-GFP assays to confirm direct interactions

    • Focus on interactions with other membrane proteins or cell wall modification enzymes (e.g., peroxidases)

  • Heterologous Expression in Arabidopsis Endodermis:

    • Express under an endodermis-specific promoter (e.g., CASP1 promoter)

    • Assess localization to the Casparian Strip Domain (CSD)

    • Compare with known CASP protein behavior

  • Domain Deletion Analysis:

    • Create constructs lacking specific transmembrane domains or extracellular loops

    • Assess effects on membrane domain formation and stability

    • Based on AtCASP1 studies, focus on conserved residues in TM3 and extracellular loops

How does abiotic stress affect the expression of Sb02g009660 in Sorghum bicolor?

Methodological approach for comprehensive stress response analysis:

  • Experimental Design:

    • Grow Sorghum bicolor seedlings under controlled conditions

    • Apply specific stress treatments:

      • Drought: 20% PEG-6000 solution or soil water deficit

      • Salt: 150-200 mM NaCl

      • Heat: 40-42°C

      • Cold: 4°C

      • ABA treatment: 100 μM ABA

      • Nutrient stress: Zn deficiency/excess

  • Tissue Collection Timeline:

    • Collect root, stem, and leaf samples at specific intervals (0, 3, 6, 12, 24, and 48 hours) post-treatment

  • Expression Analysis:

    • Extract RNA and perform RT-qPCR using Sb02g009660-specific primers

    • Normalize to appropriate reference genes stable under stress conditions

    • Present data as fold-change relative to untreated controls

  • Statistical Analysis:

    • Perform ANOVA followed by Tukey's test for significance determination

    • Generate heat maps showing expression patterns across tissues and time points

Table 1: Recommended experimental design for stress response analysis of Sb02g009660

Stress TypeTreatment ConditionsSampling Time Points (hours)Tissues
Drought20% PEG-60000, 3, 6, 12, 24, 48Root, stem, leaf
Salt200 mM NaCl0, 3, 6, 12, 24, 48Root, stem, leaf
Heat42°C0, 1, 3, 6, 12, 24Root, stem, leaf
Cold4°C0, 3, 6, 12, 24, 48Root, stem, leaf
ABA100 μM ABA0, 1, 3, 6, 12, 24Root, stem, leaf
Zn stress0 μM Zn / 500 μM Zn0, 24, 48, 72, 96Root, stem, leaf

How can I determine if Sb02g009660 is involved in osmotic stress response in Sorghum bicolor?

Based on research showing protein secretion as a major component of sorghum response to osmotic stress , the following methodological approach is recommended:

  • Cell Suspension Culture System:

    • Establish Sorghum bicolor cell suspension cultures

    • Induce osmotic stress using sorbitol treatments (0.4M, 0.6M, 0.8M)

    • Collect cells and culture medium at intervals (0, 6, 12, 24, 48 hours)

  • Protein Expression Analysis:

    • Extract total protein and extracellular matrix proteins

    • Perform Western blot analysis using antibodies against Sb02g009660 or epitope tags

    • Quantify protein levels using densitometry

  • Proteomic Analysis:

    • Use isobaric tags for relative and absolute quantification (iTRAQ) technology

    • Compare protein abundance in control vs. stressed conditions

    • Identify co-regulated proteins functioning in the same pathway

  • Protein Secretion Analysis:

    • Distinguish between cellular and secreted fractions

    • Verify if Sb02g009660 is among the secreted proteins under stress

    • Compare with known stress-responsive proteins (redox proteins, proteases, glycosyl hydrolases)

How do extracellular loops contribute to Sb02g009660 function?

Based on research with AtCASP1, extracellular loops can play complex roles in protein localization and function. Methodological approach for investigation:

  • Loop Deletion and Mutation Analysis:

    • Create constructs with:

      • Complete deletion of EL1 (Δ equivalent to AtCASP1 Δ72:80)

      • Complete deletion of EL2 (Δ equivalent to AtCASP1 Δ158:175)

      • Point mutations of conserved residues (focus on:

        • Conserved Cys residues (similar to AtCASP1 C168, C175)

        • Conserved aromatic residues (similar to AtCASP1 W164, F174)

        • Conserved Gly residues (similar to AtCASP1 G158)

  • Functional Analysis of Mutants:

    • Express in appropriate system (Arabidopsis endodermis or sorghum cells)

    • Analyze localization pattern using fluorescence microscopy

    • Measure membrane domain stability using FRAP

    • Assess protein-protein interaction capabilities

  • Comparative Analysis with Other CASPLs:

    • Align sequences focusing on extracellular loops

    • Identify sorghum-specific residues versus generally conserved residues

    • Correlate with known functional differences

  • Structure Prediction and Modeling:

    • Use programs like AlphaFold to predict structural impacts of mutations

    • Model potential interaction surfaces with other proteins

What approaches can determine if Sb02g009660 contains the nine-amino acid signature in EL1 found in endodermis-expressed CASP proteins?

Research has identified a conserved nine-amino acid signature (ESLPFFTQF) in EL1 of endodermis-expressed CASP proteins. To investigate this in Sb02g009660:

  • Sequence Analysis:

    • Perform multiple sequence alignment with known CASPs containing this signature

    • Compare specifically with Arabidopsis CASPs and Lotus japonicus CASPs

    • Analyze conservation across monocots vs. dicots

  • Promoter-Reporter Analysis:

    • Clone ~2kb upstream region of Sb02g009660

    • Fuse to a GFP reporter gene

    • Transform into Arabidopsis

    • Assess if expression pattern matches endodermis-specific pattern

  • Domain Swapping Experiments:

    • Replace EL1 in Sb02g009660 with the nine-amino acid signature if absent

    • Replace EL1 in Sb02g009660 with non-conserved sequences if present

    • Analyze effects on localization and expression pattern

How can I analyze the evolutionary relationship of Sb02g009660 with other CASP-like proteins across plant species?

Methodological approach for evolutionary analysis:

  • Comprehensive Sequence Collection:

    • Retrieve CASP and CASPL sequences from:

      • Monocots: Sorghum bicolor, Oryza sativa, Zea mays, Hordeum vulgare, Brachypodium

      • Dicots: Arabidopsis thaliana, Mimulus guttatus, Utricularia gibba

      • Non-vascular plants: Physcomitrella patens

      • Lycophytes: Selaginella moellendorffii

      • Green algae

  • Phylogenetic Analysis:

    • Perform multiple sequence alignment using MUSCLE or MAFFT

    • Construct phylogenetic trees using:

      • Maximum Likelihood method with appropriate substitution model

      • Bayesian inference

    • Apply bootstrapping (1000 replicates) for statistical support

    • Root tree with appropriate outgroup (e.g., algal sequences)

  • Synteny Analysis:

    • Compare genomic regions containing Sb02g009660 with syntenic regions in other species

    • Use visualization tools to illustrate conservation and rearrangements

    • Identify conserved gene clusters

Table 2: Expected CASP-like protein distribution across plant lineages for comparative analysis

Plant GroupRepresentative SpeciesExpected CASPL NumberEL1 Signature Present
Green algaeChlamydomonasFew CASPLsNo
BryophytesPhyscomitrella patensMultiple CASPLsNo
LycophytesSelaginella moellendorffiiMultiple CASPLsNo
MonocotsSorghum bicolor27+ CASPLsYes (subset)
MonocotsOryza sativa21 CASPLsYes (subset)
MonocotsZea mays20 CASPLsYes (subset)
DicotsArabidopsis thalianaMultiple CASPLsYes (subset)
Parasitic plantsStriga hermonticaFew functional CASPLsVariable
Carnivorous plantsUtricularia gibbaCASPLs without EL1 signatureNo

What methods can identify proteins interacting with Sb02g009660 in vivo?

Comprehensive protein interaction analysis methodology:

  • Yeast Two-Hybrid Screening:

    • Clone Sb02g009660 as bait (consider using specific domains rather than full-length if membrane protein causes difficulties)

    • Screen against Sorghum bicolor cDNA library

    • Validate positive interactions through targeted Y2H assays

    • Consider membrane-specific Y2H systems for transmembrane proteins

  • Co-Immunoprecipitation:

    • Generate antibodies against Sb02g009660 or use epitope-tagged version

    • Prepare membrane fractions from Sorghum tissues

    • Immunoprecipitate protein complexes

    • Identify interacting proteins by mass spectrometry

    • Validate with reciprocal co-IP

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse Sb02g009660 to N-terminal half of YFP

    • Fuse candidate interactors to C-terminal half of YFP

    • Co-express in plant cells (protoplasts initially)

    • Visualize reconstituted fluorescence indicating interaction

    • Focus on membrane localization patterns

  • Proximity-Dependent Biotin Identification (BioID):

    • Fuse Sb02g009660 to a promiscuous biotin ligase (BirA*)

    • Express in plant cells

    • Identify biotinylated proteins by streptavidin pull-down and mass spectrometry

    • Particularly useful for detecting transient or weak interactions

How can I investigate if Sb02g009660 interacts with lignin polymerization machinery like other CASP proteins?

Based on known CASP protein functions , the following methodological approach is recommended:

  • Targeted Interaction Analysis:

    • Focus on known components of lignin polymerization:

      • Peroxidases (particularly class III)

      • Laccases

      • Dirigent proteins

      • Monolignol transporters

    • Use pull-down assays with recombinant proteins

    • Perform in vitro binding assays with purified components

  • In Planta Co-localization:

    • Co-express fluorescently-tagged Sb02g009660 with tagged lignin biosynthesis enzymes

    • Use high-resolution confocal microscopy to assess spatial proximity

    • Perform time-lapse imaging to capture dynamic interactions

  • Functional Assays:

    • Develop an in vitro system to measure lignin polymerization activity

    • Test if addition of recombinant Sb02g009660 affects enzyme kinetics

    • Compare wild-type protein with mutated versions lacking key domains

  • Biochemical Analysis:

    • Assess if Sb02g009660 can directly bind monolignols or lignin oligomers

    • Investigate potential redox activity that could contribute to polymerization

    • Determine if post-translational modifications affect interaction capabilities

How can I determine if Sb02g009660 contributes to drought tolerance in Sorghum bicolor?

Research has shown that sorghum responds to osmotic stress through protein secretion , and SbHyPRPs show differential expression under drought conditions . To investigate Sb02g009660's role in drought tolerance:

  • Comparative Expression Analysis:

    • Compare expression of Sb02g009660 between drought-tolerant and drought-sensitive sorghum varieties

    • Use qRT-PCR to measure expression under controlled drought conditions

    • Establish correlation between expression levels and physiological drought tolerance traits

  • Functional Analysis Through Genetic Modification:

    • Generate Sb02g009660 overexpression lines in sorghum

    • Create CRISPR/Cas9 knockout or knockdown lines

    • Assess phenotypic responses to drought stress:

      • Relative water content

      • Photosynthetic efficiency (Fv/Fm)

      • Stomatal conductance

      • Biomass accumulation

      • Root architecture changes

  • Cellular Response Analysis:

    • Use cell suspension cultures from modified and wild-type plants

    • Apply osmotic stress with sorbitol or PEG

    • Measure cell viability, membrane integrity, and ROS production

    • Analyze extracellular matrix composition changes

  • Detailed Physiological Characterization:

    • Compare water use efficiency between wild-type and modified plants

    • Measure ABA sensitivity and signaling

    • Assess root hydraulic conductivity

    • Analyze cell wall composition changes in response to water deficit

What advanced methods can determine if Sb02g009660 contributes to cell wall integrity under stress conditions?

Since CASP proteins direct cell wall modifications , and sorghum shows protein secretion responses to stress , the following methodological approaches can assess Sb02g009660's role in cell wall integrity:

  • Cell Wall Compositional Analysis:

    • Compare wild-type and Sb02g009660-modified plants

    • Use Fourier Transform Infrared (FTIR) spectroscopy for non-destructive analysis

    • Perform detailed biochemical fractionation of cell wall components

    • Quantify lignin, cellulose, hemicellulose, and pectin content

  • Mechanical Property Measurements:

    • Assess cell wall extensibility using extensometers

    • Measure tissue breaking strength

    • Determine elastic modulus of cell walls

    • Compare these properties under normal and stress conditions

  • Microscopic Visualization:

    • Use transmission electron microscopy to visualize cell wall ultrastructure

    • Apply specific stains for lignin (phloroglucinol-HCl)

    • Use immunolabeling with antibodies against cell wall epitopes

    • Perform correlative light and electron microscopy on the same sample

  • Metabolite Profiling:

    • Analyze accumulation of cell wall precursors

    • Profile monolignols and lignin oligomers

    • Track isotope-labeled cell wall components to measure turnover rates

    • Compare metabolic flux through cell wall biosynthesis pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.