Recombinant Sorghum bicolor CASP-like protein Sb03g029220 (Sb03g029220)

Shipped with Ice Packs
In Stock

Description

Role in Casparian Strip Formation

  • CASP proteins like Sb03g029220 are critical for forming Casparian strips, lignin-rich barriers in root endodermal cells that regulate nutrient uptake .

  • In Arabidopsis, CASPs localize to membrane domains and interact with receptor-like kinases (e.g., SGN3) to ensure contiguous strip formation .

  • Loss of CASP functionality disrupts lignin deposition, leading to defective barriers and compensatory suberin accumulation .

Stress Response and Redundancy

  • Homologs in watermelon (ClCASPL) and Arabidopsis (AtCASPL4C1) are implicated in cold tolerance and growth regulation .

  • Mutations in CASPL genes alter transcriptional regulation of lignin biosynthesis enzymes but show redundancy in Casparian strip formation .

Applications

Sb03g029220 is primarily used in:

  1. ELISA and Immunoassays: As an antigen for antibody validation .

  2. Protein Interaction Studies: To investigate CASP-SGN3 kinase interactions in membrane domain assembly .

  3. Structural Analysis: Transmembrane domain characterization via mutagenesis .

Key Challenges and Future Directions

  • Functional Redundancy: Multiple CASP isoforms complicate loss-of-function studies .

  • Mechanistic Insights: The role of Sb03g029220 in sorghum-specific stress responses remains unexplored .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format readily available in our inventory, we are open to accommodating specific format requirements. Kindly specify any such preferences in your order remarks, and we will prepare the product accordingly.
Lead Time
Delivery timelines may vary based on the chosen purchasing method and location. For specific delivery estimates, please reach out to your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. Should you require dry ice packaging, please communicate this in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. To facilitate long-term storage at -20°C/-80°C, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution. Our default final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. To maintain product integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production process. If you have a specific tag type in mind, please inform us and we will prioritize development according to your specifications.
Synonyms
Sb03g029220; CASP-like protein 4U1; SbCASPL4U1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-461
Protein Length
full length protein
Species
Sorghum bicolor (Sorghum) (Sorghum vulgare)
Target Names
Sb03g029220
Target Protein Sequence
MASTPRTPAPVRSPPPVPTPTHPTPPPPPLETPQPPLPVSTPPPALETPPPRRVRTPPPP LETPPPPSPSSSQPGDEYHTPAPSLADGSPREEEASFPSDGREGGGAPAPPKSPQLSPMR LAAPRLLLPPPSPRTPTGQNGQEEQEGGAKAAAAGAGTGTGTAAPARQQLRLTGLARSPS SQRSLATTNSSPSPSPSPTPPSPLTPAAAPVVNNNSNNKNNRSGQSTPKRAAETKLPLSS PAATATIAVQHFNPVEEAVTSPLHLGIGKAQRLDHHQHQHQQRQEQHAAAAAVENGGSVP PDVAAAVAVGERRELSVTLRLATAVLSLAAFSVIASARTSGWAGDYYAHHLQYRYAVAVN VIVCAYSIAQSFGEIRRLISPRFIFRSMSSYYCSLFLDQALAYLLMSASSAAASRNDLWV SRFGTDAFNRKITSALWLSFIAFLMLALNALISTANLFSML
Uniprot No.

Target Background

Database Links

KEGG: sbi:8058222

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Sorghum bicolor CASP-like protein Sb03g029220 and what is its biological function?

Sorghum bicolor CASP-like protein Sb03g029220 is a membrane protein that belongs to the Casparian Strip Membrane Domain Protein (CASP) family. The protein is encoded by the Sb03g029220 gene in Sorghum bicolor (sorghum). CASPs are four-membrane-span proteins that play a crucial role in the formation of Casparian strips in plant endodermal cells . The primary function of CASP proteins is to serve as membrane scaffolds that recruit lignin polymerization machinery for the formation of Casparian strips .

The specific role of Sb03g029220 in Sorghum bicolor likely involves:

  • Localization to specialized membrane domains in endodermal cells

  • Recruitment of enzymes involved in lignin polymerization

  • Contribution to the formation of apoplastic barriers in plant roots

  • Regulation of nutrient and water uptake through the root system

This protein exhibits high stability in its membrane domain, suggesting it functions as part of a structural scaffold complex that mediates the deposition of cell wall material in specific membrane domains .

How should Sb03g029220 recombinant protein be stored and handled for optimal stability?

For optimal stability and activity, recombinant Sb03g029220 protein should be handled according to these guidelines:

Storage conditions:

  • Store at -20°C for regular storage

  • For extended storage, conserve at -20°C or -80°C

  • Working aliquots can be maintained at 4°C for up to one week

Buffer composition:

  • Tris-based buffer with 50% glycerol, optimized for this specific protein

  • The buffer is formulated to maintain protein stability and prevent denaturation

Handling recommendations:

  • Avoid repeated freeze-thaw cycles as they can lead to protein degradation and activity loss

  • Prepare small working aliquots to minimize freeze-thaw cycles

  • Thaw samples on ice when removing from frozen storage

  • Centrifuge the product briefly after thawing to collect all material at the bottom of the tube

Following these guidelines will help maintain the structural integrity and functional activity of the recombinant protein for experimental applications.

What experimental design considerations are critical when studying Sb03g029220 function in planta?

When investigating Sb03g029220 function in planta, several experimental design considerations are essential for obtaining reliable and meaningful results:

Blocking and Randomization:

  • Implement blocking strategies to group similar experimental units, reducing variability within each block

  • This enhances detection of treatment effects and allows for more precise estimates of protein function

  • Efficient allocation of resources through blocking helps achieve reliable results with fewer experimental units

Control for Nuisance Variables:

  • Identify and control for variables that may influence protein expression or function but are not part of the primary research question

  • Reduce bias through proper randomization and control selection

  • Include appropriate negative and positive controls for validation of observed effects

Tissue-Specific Expression Analysis:

  • Since CASP proteins function primarily in endodermal tissues, experimental design should include:

    • Cell-type specific isolation techniques

    • Tissue-specific promoters for transgene expression

    • Developmental stage considerations due to temporal regulation of CASP expression

Genetic Redundancy Considerations:

  • Address potential functional redundancy among CASP family members

  • Consider using CRISPR/Cas9 approaches similar to those used for kafirin genes in sorghum

  • Design guide RNAs targeting conserved regions if multiple gene family members need to be edited simultaneously

Phenotypic Evaluation Metrics:

  • Develop quantitative measurements for Casparian strip integrity

  • Establish assays for nutrient uptake efficiency

  • Design experiments to measure stress responses related to endodermal barrier function

This systematic approach to experimental design will maximize statistical power while minimizing resource expenditure and experimental bias .

How can gene editing approaches be optimized for studying Sb03g029220 function?

Optimizing gene editing approaches for studying Sb03g029220 function requires strategic planning and consideration of several technical factors:

CRISPR/Cas9 Target Site Selection:

  • Design single guide RNAs (sgRNAs) targeting conserved regions of Sb03g029220

  • Consider targeting the signal peptide encoding region, similar to successful approaches used for kafirin genes in sorghum

  • Evaluate potential off-target effects using appropriate computational tools

Editing Efficiency Assessment:

  • Sequence PCR products to verify editing efficiency

  • Use T7 endonuclease I assay for rapid screening of edited lines

  • Implement targeted deep sequencing for comprehensive mutation profiling

Transgene-Free Mutant Recovery:

  • Employ strategies to obtain transgene-free edited plants through segregation

  • Screen T1 and T2 generations to identify homozygous edited plants lacking the CRISPR/Cas9 transgene

  • Verify the absence of transgene integration using PCR and Southern blot analysis

Phenotypic Analysis Framework:

Analytical ApproachMethodologyExpected Outcomes
Confocal microscopyPropidium iodide stainingVisualization of Casparian strip integrity
Physiological assaysIon leakage measurementQuantification of barrier function
Transcriptomic analysisRNA-seq of root tissuesIdentification of compensatory mechanisms
Protein localizationFluorescent protein fusionSubcellular localization patterns

Using this comprehensive approach, researchers can generate valuable mutant lines that enable detailed functional characterization of Sb03g029220 in sorghum development and stress responses .

What comparative genomics approaches can reveal evolutionary insights about Sb03g029220?

Comparative genomics approaches can provide significant evolutionary insights about Sb03g029220 through systematic analysis of CASP proteins across plant species:

Phylogenetic Analysis Framework:

  • Construct phylogenetic trees using CASP-like protein sequences from diverse plant species

  • Identify orthologous relationships between Sb03g029220 and CASP proteins in model plants

  • Determine the evolutionary history of gene duplication events within the CASP family

Structural Conservation Analysis:

  • Compare transmembrane domain organization across CASP family members

  • Identify conserved motifs that may be essential for protein function

  • Analyze the evolutionary conservation of protein interaction domains

Selection Pressure Assessment:

  • Calculate Ka/Ks ratios to determine whether Sb03g029220 has been under purifying, neutral, or positive selection

  • Identify specific amino acid positions under selection pressure

  • Correlate evolutionary rate with functional domains to infer important structural regions

Synteny Analysis:

  • Examine genomic context of CASP genes across species

  • Identify conserved gene clusters that may indicate functional relationships

  • Analyze promoter evolution to understand divergence in expression patterns

This multi-faceted comparative approach can reveal how CASP proteins have evolved across plant lineages, potentially identifying specialized adaptations in sorghum related to environmental stress tolerance or root development .

What methodologies are most effective for analyzing the membrane localization and protein-protein interactions of Sb03g029220?

Investigating membrane localization and protein-protein interactions of Sb03g029220 requires specialized approaches suitable for membrane proteins:

Membrane Localization Techniques:

  • Confocal laser scanning microscopy with fluorescent protein fusions

  • Super-resolution microscopy for detailed localization within membrane domains

  • Immunogold electron microscopy for ultrastructural localization

  • Membrane fractionation followed by Western blot analysis

Protein-Protein Interaction Analysis:

  • Split-ubiquitin yeast two-hybrid system (specifically designed for membrane proteins)

  • Bimolecular fluorescence complementation (BiFC) for in vivo interaction visualization

  • Co-immunoprecipitation with specialized detergent conditions optimized for membrane proteins

  • Proximity-dependent biotin identification (BioID) for detecting transient interactions

Functional Reconstitution Systems:

  • Heterologous expression in Xenopus oocytes

  • Proteoliposome reconstitution for biochemical assays

  • Cell-free expression systems with artificial membrane environments

Dynamic Interaction Analysis:

  • Fluorescence recovery after photobleaching (FRAP) to assess protein mobility in membranes

  • Single-molecule tracking to determine diffusion rates and interaction dynamics

  • Förster resonance energy transfer (FRET) for quantifying interaction affinities

Implementation of these complementary techniques can provide a comprehensive understanding of how Sb03g029220 assembles into functional complexes at the plasma membrane and interacts with the cell wall modification machinery to form Casparian strips .

How should experimental controls be designed for functional analysis of Sb03g029220?

Designing appropriate experimental controls is essential for robust functional analysis of Sb03g029220:

Genetic Controls:

  • Wild-type controls from the same genetic background

  • Non-expressing transformants containing the same vector backbone

  • Plants expressing mutated versions of Sb03g029220 with specific domain alterations

  • Knockdown or knockout lines of related CASP family members for specificity assessment

Tissue-Specific Expression Controls:

  • Expression under native promoter compared to constitutive promoter

  • Cell-type specific markers to validate localization patterns

  • Developmental stage series to account for temporal regulation

Physiological Response Controls:

  • Normal growth conditions versus stress treatments

  • Recovery experiments after stress removal

  • Dose-response experiments for nutrient availability

Molecular Analysis Controls:

  • Standard curves for qPCR analysis of gene expression

  • Loading controls for Western blot protein quantification

  • Empty vector controls for protein interaction assays

  • Unrelated membrane protein controls to distinguish specific from non-specific effects

By implementing this comprehensive control strategy, researchers can effectively isolate the specific effects of Sb03g029220 manipulation from background variation and non-specific responses, leading to more reliable and interpretable results .

What are the challenges and solutions for recombinant expression of Sb03g029220?

Recombinant expression of membrane proteins like Sb03g029220 presents several challenges that require specialized approaches:

Expression System Selection Challenges:

Expression SystemAdvantagesLimitationsSolutions
E. coliCost-effective, rapidLimited for membrane proteinsUse specialized strains (C41/C43)
Insect cellsBetter for eukaryotic proteinsHigher cost, slowerOptimize codon usage for expression
Plant expressionNative folding environmentLower yieldsUse transient expression systems
Cell-free systemsDirect membrane incorporationTechnical complexitySupplement with chaperones and lipids

Solubilization and Purification Strategies:

  • Test multiple detergents (DDM, LMNG, GDN) for optimal solubilization

  • Employ lipid nanodiscs or amphipols for maintaining native-like environment

  • Implement two-step purification using affinity chromatography followed by size exclusion

  • Consider fusion tags that enhance solubility while maintaining function

Refolding Approaches:

  • Develop protocols for gradual detergent exchange

  • Use artificial membrane environments for reconstitution

  • Optimize buffer conditions including pH, ionic strength, and glycerol concentration

  • Consider chaperone co-expression to enhance proper folding

Functional Verification Methods:

  • Develop activity assays specific to CASP-like proteins

  • Validate proper folding through circular dichroism spectroscopy

  • Confirm membrane integration using protease protection assays

  • Verify oligomerization state through analytical ultracentrifugation

By addressing these challenges systematically, researchers can successfully express and purify functional Sb03g029220 for structural and biochemical studies, advancing our understanding of CASP protein function .

What imaging techniques provide the most valuable data for studying Sb03g029220 localization and function?

Advanced imaging techniques offer powerful approaches for studying Sb03g029220 localization and function:

Confocal Laser Scanning Microscopy:

  • Enables visualization of fluorescently tagged Sb03g029220 in living tissues

  • Allows for colocalization studies with other proteins or cellular structures

  • Can be combined with time-lapse imaging to track dynamic processes

  • Limitations include resolution constraints and potential artifacts from overexpression

Super-Resolution Microscopy Approaches:

  • Structured illumination microscopy (SIM) provides 2x improvement in resolution

  • Stimulated emission depletion (STED) microscopy offers resolution down to 30-50 nm

  • Single-molecule localization microscopy (PALM/STORM) achieves near-molecular resolution

  • These techniques can resolve the precise organization of Sb03g029220 within Casparian strip domains

Correlative Light and Electron Microscopy (CLEM):

  • Combines the specificity of fluorescence microscopy with ultrastructural detail from EM

  • Allows precise localization of Sb03g029220 relative to cell wall features

  • Provides nanometer-scale resolution of protein organization

  • Can reveal the relationship between protein localization and Casparian strip formation

Functional Imaging Approaches:

  • Fluorescence recovery after photobleaching (FRAP) to measure protein mobility

  • Fluorescence loss in photobleaching (FLIP) to analyze continuity of membrane domains

  • Förster resonance energy transfer (FRET) to detect protein-protein interactions

  • Ratiometric fluorescent sensors to monitor local ion concentrations or pH changes

The integration of these complementary imaging approaches provides a comprehensive understanding of how Sb03g029220 organizes within membrane domains and contributes to Casparian strip formation in sorghum .

How can understanding Sb03g029220 function contribute to improving sorghum stress tolerance?

Understanding Sb03g029220 function can significantly impact strategies for improving sorghum stress tolerance through several mechanisms:

Water Use Efficiency Enhancement:

  • CASP proteins form part of the apoplastic barrier system in roots

  • Modulation of Sb03g029220 expression could optimize water uptake and reduce water loss

  • Targeted modifications may enhance drought tolerance without compromising nutrient acquisition

Nutrient Uptake Regulation:

  • Casparian strips controlled by CASP proteins regulate selective nutrient transport

  • Engineering Sb03g029220 function could improve nitrogen and phosphorus uptake efficiency

  • This may reduce fertilizer requirements while maintaining or improving yield

Salt Stress Tolerance Strategies:

  • CASP-mediated barriers restrict Na+ movement into the vascular system

  • Enhancing Sb03g029220 function could improve salt exclusion mechanisms

  • This approach may expand sorghum cultivation to marginal, saline soils

Integrated Stress Response Optimization:

  • Comparative analysis with other CASP family members may reveal specialized functions

  • Engineering CASP expression patterns could create customized barrier properties

  • Fine-tuning of Sb03g029220 activity could balance tradeoffs between different stress tolerances

By leveraging our understanding of Sb03g029220 function, researchers can develop sorghum varieties with enhanced resilience to multiple environmental stresses, contributing to sustainable agriculture in challenging climates .

What molecular breeding strategies can utilize Sb03g029220 for crop improvement?

Several molecular breeding strategies can leverage Sb03g029220 for sorghum improvement:

Precision Editing Approaches:

  • CRISPR/Cas9-mediated modification of Sb03g029220 regulatory regions

  • Introduction of specific allelic variants identified from germplasm screening

  • Creation of conditional expression systems for stress-responsive activation

  • Development of transgene-free edited lines for commercial deployment

Marker-Assisted Selection:

  • Identification of natural variation in Sb03g029220 sequence and expression

  • Development of molecular markers linked to beneficial alleles

  • Implementation in breeding programs to track desirable haplotypes

  • Combining with genomic selection for accelerated improvement

Promoter Engineering:

  • Modification of Sb03g029220 expression patterns through promoter engineering

  • Development of stress-inducible or tissue-specific promoters

  • Fine-tuning of expression levels to optimize barrier function

  • Creation of synthetic promoters with enhanced responsiveness to specific stresses

Multi-gene Stacking Strategies:

  • Combining optimized Sb03g029220 alleles with complementary genes

  • Coordinated modification of multiple CASP family members

  • Integration with other barrier function genes for synergistic effects

  • Development of trait packages for specific environmental challenges

These molecular breeding strategies can be implemented using gene editing approaches similar to those successfully applied to kafirin genes in sorghum, leading to improved varieties with enhanced stress tolerance and resource use efficiency .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.