Recombinant Sorghum bicolor CASP-like protein Sb03g033320 (Sb03g033320)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will strive to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize development of the specified tag.
Synonyms
Sb03g033320; CASP-like protein 3A1; SbCASPL3A1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-211
Protein Length
full length protein
Species
Sorghum bicolor (Sorghum) (Sorghum vulgare)
Target Names
Sb03g033320
Target Protein Sequence
MGSIGNGRSDSVVGIQMPPAGSKMVLEPEALQVTTSPVPRWPRLGVVMVATRAVAMVMAL LSMSLMVSSKQRGILTIFGIEIPLDANWSFSYSLQFLVAMSTASAAYSLAQLLLIAHKAV KKSPIVPSRRHAWLLFAGDQVFSLAMMSAGSAAAAVANLNRTGIRHTALPNFCKPLPRFC DLSAVSIACAFLSCVFLAASAVIDVIWLSSP
Uniprot No.

Target Background

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Sorghum bicolor CASP-like protein Sb03g033320 and what is its role in plants?

Sorghum bicolor CASP-like protein Sb03g033320 (UniProt accession: C5XIF2) is a member of the Casparian strip membrane domain protein (CASP)-like family found in Sorghum bicolor, commonly known as sorghum. This protein plays a critical role in the formation of lignin-based barriers in plant tissues . These barriers are essential components of the plant's defense system against pathogenic invasion and contribute to the regulation of nutrient and water transport across cellular boundaries. The protein consists of 211 amino acids and functions similarly to other CASP-like proteins by organizing the deposition of lignin in specific membrane domains . Research indicates that CASP-like proteins are involved in the organization of the Casparian strip, a specialized cell wall modification that forms a diffusion barrier in plant roots, controlling the movement of water and solutes between the soil and vascular tissues .

What is the relationship between Sb03g033320 and other CASP-like proteins in Sorghum bicolor?

Sorghum bicolor possesses multiple CASP-like proteins, including Sb03g033320 and Sb04g002820, which share functional similarities but differ in their amino acid sequences and potentially in their specific roles . Comparative analysis reveals that while Sb03g033320 consists of 211 amino acids, Sb04g002820 is significantly larger with 452 amino acids . This difference in sequence length and composition suggests distinct evolutionary paths and potentially specialized functions within the plant's physiological processes.

Both proteins belong to the broader CASP-like family that contributes to the formation of lignin-based barriers in plants, but their expression patterns and tissue-specific activities may vary. Research indicates that different CASP-like proteins may be recruited for barrier formation in different plant tissues or in response to various environmental stressors, highlighting the specialized nature of these proteins within the plant's defensive and regulatory systems .

What experimental evidence supports the role of Sb03g033320 in lignin-based barrier formation?

Evidence from studies on CASP-like proteins, including Sb03g033320, demonstrates their involvement in lignin-based barrier formation in plants. Research has shown that in Arabidopsis, CASP-like proteins are essential for the accumulation of lignin in response to bacterial pathogens, functioning in a manner dependent on the plant's immune response pathways . This lignin accumulation creates barriers that restrict pathogen movement and proliferation within plant tissues.

The involvement of Sb03g033320 in barrier formation is further supported by its structural similarities to well-characterized CASP proteins that organize the Casparian strip in roots. These similarities include membrane localization domains and motifs associated with the recruitment of lignin biosynthesis enzymes. When plants encounter incompatible pathogens, CASP-like proteins including Sb03g033320 are believed to orchestrate the deposition of lignin, effectively creating a physical barrier that isolates invading pathogens and prevents their spread throughout the plant tissue .

What are the optimal conditions for recombinant expression and purification of Sb03g033320?

The recombinant expression and purification of Sorghum bicolor CASP-like protein Sb03g033320 requires careful optimization to maintain protein functionality. Based on established protocols for membrane-associated proteins, the following methodological approach is recommended:

Expression System Selection:

  • Bacterial systems (E. coli): Use specialized strains designed for membrane protein expression (C41(DE3), C43(DE3))

  • Eukaryotic systems: Consider insect cells (Sf9, High Five) for proper folding and post-translational modifications

Expression Optimization Parameters:

ParameterRecommended ConditionsNotes
Induction temperature16-20°CLower temperatures reduce aggregation
Induction duration16-24 hoursExtended time for proper folding
Inducer concentration0.1-0.5 mM IPTG (for bacterial)Lower concentrations favor soluble expression
Cell density at inductionOD600 0.6-0.8Optimal metabolic state

Purification Strategy:

  • Cell lysis using mild detergents (DDM, LDAO, or Triton X-100)

  • Initial capture with immobilized metal affinity chromatography (IMAC)

  • Secondary purification with size exclusion chromatography

  • Buffer optimization containing 50% glycerol in Tris-based buffer

The purified protein should be stored at -20°C for regular use or -80°C for extended storage . Repeated freeze-thaw cycles should be strictly avoided to prevent protein denaturation, with working aliquots maintained at 4°C for no longer than one week .

How can researchers effectively study protein-protein interactions involving Sb03g033320?

Investigating protein-protein interactions (PPIs) of Sb03g033320 requires a multi-faceted approach combining in vitro, in vivo, and in silico techniques:

In Vitro Methods:

  • Co-immunoprecipitation (Co-IP): Using antibodies specific to Sb03g033320 or potential interacting partners

  • Pull-down assays: Utilizing recombinant Sb03g033320 with an affinity tag as bait

  • Surface Plasmon Resonance (SPR): For quantitative analysis of binding kinetics

  • Isothermal Titration Calorimetry (ITC): To determine thermodynamic parameters of interactions

In Vivo Methods:

  • Bimolecular Fluorescence Complementation (BiFC): For visualizing interactions in plant cells

  • Förster Resonance Energy Transfer (FRET): To detect close-proximity interactions

  • Yeast Two-Hybrid (Y2H) screening: Adapted for membrane proteins using split-ubiquitin system

In Silico Approaches:

  • Protein docking simulations: To predict interaction interfaces

  • Network analysis: To identify functional modules involving Sb03g033320

  • Evolutionary coupling analysis: To predict co-evolving residues indicating interaction sites

When implementing these methods, researchers should pay particular attention to maintaining the native membrane environment of Sb03g033320 to preserve physiologically relevant interactions. For in vitro studies, the inclusion of appropriate detergents or lipid nanodiscs is crucial to maintain protein structure and function. Additionally, controls using non-specific proteins or mutated versions of Sb03g033320 should be employed to distinguish genuine interactions from experimental artifacts.

What knockout/knockdown strategies are most effective for studying Sb03g033320 function?

To elucidate the function of Sb03g033320 through loss-of-function approaches, researchers can employ several genetic modification strategies:

CRISPR/Cas9 Gene Editing:

  • Design guide RNAs targeting conserved regions of the Sb03g033320 gene

  • Utilize Agrobacterium-mediated transformation for sorghum callus

  • Screen transformants using PCR-based genotyping and sequencing

  • Verify knockout at protein level using Western blotting

RNAi-Mediated Knockdown:

  • Construct hairpin RNA vectors targeting Sb03g033320 mRNA

  • Transform sorghum using optimized tissue culture protocols

  • Quantify knockdown efficiency using RT-qPCR

  • Assess protein reduction using immunoblotting

Virus-Induced Gene Silencing (VIGS):

  • Design VIGS vectors carrying Sb03g033320 fragments

  • Introduce vectors through Agrobacterium infiltration

  • Monitor silencing efficiency temporally

  • Advantage: Faster than stable transformation approaches

TILLING (Targeting Induced Local Lesions IN Genomes):

  • Screen mutagenized sorghum populations for mutations in Sb03g033320

  • Identify missense or nonsense mutations

  • Backcross to remove background mutations

Phenotypic Analysis Protocol:

  • Examine root and shoot development under normal conditions

  • Challenge plants with pathogens to assess barrier function

  • Analyze lignin deposition using histochemical staining

  • Measure diffusion of fluorescent tracers across cellular barriers

  • Quantify susceptibility to abiotic stresses (drought, salinity)

For all approaches, complementation studies reintroducing functional Sb03g033320 are essential to confirm that observed phenotypes result directly from the absence of this protein rather than off-target effects or compensatory mechanisms.

How can researchers analyze the structural properties of Sb03g033320?

Determining the structural properties of membrane-associated proteins like Sb03g033320 presents significant challenges but can be approached through a combination of experimental and computational methods:

Experimental Structure Determination:

Protein Preparation Considerations:

  • Expression with minimal tags to avoid structural interference

  • Purification in detergents that maintain native structure

  • Reconstitution in lipid environments for functional studies

  • Site-directed spin labeling for electron paramagnetic resonance (EPR) studies

Computational Structure Prediction:

  • Homology Modeling: Using related CASP proteins as templates

  • Ab initio Modeling: For regions lacking homologous structures

  • Molecular Dynamics Simulations: To study protein behavior in membrane environments

  • AlphaFold2 or RoseTTAFold: Leveraging AI-based structure prediction

Structure-Function Analysis:

  • Identify conserved regions across CASP-like proteins

  • Predict membrane-spanning domains and orientation

  • Map potential sites for protein-protein interactions

  • Design mutagenesis experiments to validate functional predictions

Researchers should integrate multiple approaches, as each method provides complementary information. For instance, computational predictions can guide the design of constructs for experimental structure determination, while low-resolution experimental data can validate and refine computational models.

How should researchers interpret contradictory findings regarding Sb03g033320 function?

When faced with contradictory findings regarding the function of Sb03g033320, researchers should implement a systematic approach to data reconciliation:

Methodological Evaluation Framework:

  • Experimental Context Analysis: Examine differences in experimental conditions, including plant growth conditions, developmental stages, and stress treatments that might explain functional variations

  • Methodological Comparison: Assess whether contradictions arise from limitations or biases inherent to different experimental approaches

  • Genetic Background Consideration: Evaluate if the genetic background of studied plants contributes to functional differences

  • Isoform Specificity: Determine if contradictions result from studying different splice variants or highly similar paralogs

Resolution Strategies:

  • Direct Comparative Studies: Design experiments that directly compare conflicting findings under identical conditions

  • Meta-analysis: Systematically analyze all available data to identify patterns and sources of variation

  • Combinatorial Approaches: Integrate multiple techniques to build a more comprehensive understanding

  • Functional Redundancy Assessment: Investigate whether other CASP-like proteins compensate when Sb03g033320 is altered

Reporting Recommendations:

  • Clearly acknowledge contradictions in the literature

  • Present alternative hypotheses that could explain discrepancies

  • Propose experiments specifically designed to resolve contradictions

  • Consider evolutionary and ecological contexts that might explain functional plasticity

By applying this structured approach, researchers can transform contradictory findings from obstacles into opportunities for deeper understanding of the context-dependent functions of Sb03g033320 and related proteins in plant barrier formation and defense responses.

How can transcriptomic data be integrated to understand Sb03g033320 expression patterns?

Integrating transcriptomic data provides valuable insights into the regulatory mechanisms and expression patterns of Sb03g033320 across different conditions, tissues, and developmental stages:

Data Collection and Processing Strategy:

  • RNA-Seq Data Sources:

    • Public repositories (SRA, ENA, GEO)

    • Custom experiments targeting specific conditions

    • Single-cell RNA-Seq for cell-type specific expression

  • Expression Analysis Approaches:

    • Differential expression across conditions

    • Temporal expression patterns

    • Tissue-specific expression profiles

    • Co-expression network construction

Integration Framework:

Analysis TypeMethodologyExpected Insights
Condition-specific expressionDifferential expression analysisStress responses, pathogen interactions
Developmental regulationTime-series analysisBarrier formation timing
Tissue specificityComparison across tissue datasetsFunctional specialization
Co-regulationWGCNA, GRN inferenceRegulatory mechanisms, functional associates

Data Visualization Strategies:

  • Heat maps for expression pattern clustering

  • Principal component analysis for sample relationships

  • Co-expression networks for functional associations

  • Genome browser tracks for regulatory element identification

Validation Approaches:

  • RT-qPCR for selected expression patterns

  • Promoter-reporter fusions to confirm tissue specificity

  • ChIP-Seq to identify transcription factor binding

  • ATAC-Seq to assess chromatin accessibility at the Sb03g033320 locus

By systematically integrating diverse transcriptomic datasets, researchers can develop a comprehensive understanding of when, where, and how Sb03g033320 is expressed, providing crucial context for interpreting functional studies and predicting the protein's role in various physiological processes.

What are the most rigorous approaches for validating hypotheses about Sb03g033320 function?

Rigorous validation of hypotheses regarding Sb03g033320 function requires a multi-layered approach combining genetic, biochemical, cellular, and physiological methodologies:

Genetic Validation Strategy:

  • Multiple Independent Mutant Lines:

    • Generate 3+ independent knockout/knockdown lines

    • Use different targeting approaches (CRISPR, RNAi, T-DNA)

    • Perform complementation tests with the wild-type gene

  • Allelic Series:

    • Create point mutations in specific domains

    • Develop partial loss-of-function alleles

    • Generate conditional mutants (inducible systems)

Biochemical Validation Approach:

  • In Vitro Activity Assays:

    • Reconstitute protein in appropriate membrane mimetics

    • Assess interaction with lignin biosynthesis enzymes

    • Quantify effects on lignin polymerization

  • Protein Interaction Confirmation:

    • Use two or more independent methods (Y2H, BiFC, Co-IP)

    • Include appropriate negative controls

    • Verify with native protein concentrations

Cellular and Tissue-Level Validation:

  • Microscopy Techniques:

    • Immunolocalization of native protein

    • Fluorescent protein fusions to track subcellular localization

    • Super-resolution microscopy to examine barrier formation

  • Barrier Function Tests:

    • Apoplastic tracer permeability assays

    • Lignin-specific staining and quantification

    • Electron microscopy of cell wall modifications

Physiological Validation:

  • Pathogen Challenge Experiments:

    • Measure pathogen spread in mutant vs. wild-type

    • Quantify defense responses

    • Assess disease susceptibility

  • Environmental Stress Tests:

    • Evaluate response to drought, salinity, nutrient deficiency

    • Measure hydraulic conductivity

    • Assess ion accumulation patterns

Statistical Rigor:

  • Adequate biological replication (minimum n=3 independent experiments)

  • Appropriate statistical tests with correction for multiple comparisons

  • Effect size calculation and reporting

  • Power analysis to determine sample size requirements

Independent Validation:

  • Cross-validation in different laboratories

  • Testing in different genetic backgrounds

  • Validation across multiple plant growth conditions

By implementing this comprehensive validation framework, researchers can establish causal relationships between Sb03g033320 and observed phenotypes with high confidence, distinguishing direct functions from indirect effects or experimental artifacts.

How can Sb03g033320 function be leveraged to enhance crop resilience to pathogens?

Understanding the role of Sb03g033320 in lignin-based barrier formation presents opportunities for enhancing crop resilience through targeted molecular approaches:

Translational Research Strategies:

  • Precision Breeding Applications:

    • Identify natural variants of Sb03g033320 with enhanced barrier-forming capability

    • Screen germplasm collections for superior alleles

    • Develop molecular markers for marker-assisted selection

    • Implement genomic selection incorporating Sb03g033320 variations

  • Genetic Engineering Approaches:

    • Modulate Sb03g033320 expression in tissue-specific patterns

    • Engineer promoter modifications for faster response to pathogen attack

    • Introduce optimized versions from resistant varieties

    • Create synthetic variants with enhanced functionality

  • Pathway Engineering:

    • Coordinate expression with lignin biosynthesis genes

    • Modify regulatory networks to accelerate barrier formation

    • Engineer stress-responsive activation systems

Implementation Framework:

ApproachMethodologyExpected OutcomeConsiderations
Constitutive overexpressionStrong promoter (e.g., CaMV 35S)Enhanced baseline defensePotential growth penalties
Pathogen-inducible expressionPathogen-responsive promotersTargeted defense activationTiming optimization crucial
Tissue-specific enhancementRoot/leaf-specific promotersLocalized barrier reinforcementTissue-specific optimization
Protein engineeringStructure-guided modificationsImproved barrier formation efficiencyFunctional validation needed

Field Testing Protocol:

  • Initial controlled environment trials

  • Small-scale field trials with diverse pathogen exposure

  • Multi-location trials across varied environments

  • Assessment of yield, quality, and broad-spectrum resistance

Potential Applications Beyond Pathogen Resistance:

  • Drought tolerance enhancement through water loss reduction

  • Improved nutrient use efficiency via controlled nutrient partitioning

  • Enhanced heavy metal tolerance through barrier-mediated exclusion

By strategically modifying Sb03g033320 function or expression patterns, researchers can potentially develop crops with enhanced resilience to multiple biotic stresses while maintaining agricultural productivity and quality.

What are the key considerations for experimental design when studying Sb03g033320 in stress responses?

Designing robust experiments to investigate Sb03g033320's role in stress responses requires careful attention to multiple variables and potential confounding factors:

Experimental Design Framework:

  • Control Group Establishment:

    • Wild-type plants of identical genetic background

    • Empty vector controls for transformation experiments

    • Mock treatments matching solvent/handling effects

  • Variable Control Strategy:

    • Standardized growth conditions (light, temperature, humidity)

    • Synchronized developmental staging

    • Consistent stress application methods

    • Temporal matching of sampling points

  • Stress Application Protocols:

Stress TypeApplication MethodMonitoring ParametersSampling Considerations
Bacterial pathogensSyringe infiltration, spray inoculationCFU counts, lesion size, pathogen spreadSample barrier zone specifically
Fungal pathogensSpore suspension applicationHyphal penetration, colonization extentInclude penetration attempts sites
DroughtControlled soil moisture deficitRelative water content, water potentialPre-dawn sampling for consistency
SalinityNaCl application to defined concentrationsNa+/K+ ratios, osmotic potentialRoot and shoot separate analysis
  • Multi-Level Analysis Approach:

    • Transcriptional responses (RT-qPCR, RNA-Seq)

    • Protein accumulation and modification (Western blot, proteomics)

    • Histochemical analysis (lignin deposition, callose formation)

    • Physiological measurements (gas exchange, hydraulic conductivity)

    • Whole-plant phenotyping (growth parameters, stress symptoms)

Statistical Design Considerations:

  • Appropriate replication (biological and technical)

  • Randomized complete block design to control environmental variation

  • Factorial designs for interaction studies

  • Time-course sampling for temporal dynamics

  • Power analysis to determine sample size

Controls for Specific Confounding Factors:

  • Age-dependent effects (use developmentally matched plants)

  • Circadian regulation (consistent sampling times)

  • Positional effects (randomization, plant rotation)

  • Preexisting stress (acclimation period before experiments)

  • Wounding responses (include wounded controls)

By implementing this comprehensive experimental design framework, researchers can generate reliable and reproducible data on Sb03g033320's involvement in stress responses, distinguishing its specific contributions from general stress responses or experimental artifacts.

How can evolutionary analysis inform our understanding of Sb03g033320 function?

Evolutionary analysis provides powerful insights into the functional significance and specialization of Sb03g033320 by placing it in a broader comparative context:

Evolutionary Analysis Approach:

  • Phylogenetic Analysis Framework:

    • Identify orthologs across diverse plant species

    • Construct robust phylogenetic trees using maximum likelihood and Bayesian methods

    • Map key functional domains and motifs across evolutionary history

    • Identify lineage-specific expansions or losses

  • Selection Pressure Analysis:

    • Calculate dN/dS ratios across different protein regions

    • Identify sites under positive, negative, or relaxed selection

    • Compare selection patterns between crop and wild species

    • Correlate selection with environmental adaptations

  • Comparative Genomics Strategy:

    • Analyze synteny and genomic context conservation

    • Examine regulatory element evolution

    • Identify co-evolving gene clusters

    • Compare copy number variations across species

Evolutionary-Functional Correlation:

Evolutionary PatternFunctional ImplicationValidation Approach
High conservation in specific domainsCritical functional regionsTargeted mutagenesis
Positive selection in surface residuesHost-pathogen co-evolutionPathogen interaction studies
Lineage-specific motifsSpecialized functionsDomain swapping experiments
Co-evolution with lignin synthesis genesFunctional interactionCo-expression analysis

Ancestral State Reconstruction:

  • Infer ancestral sequences at key evolutionary nodes

  • Experimentally resurrect and characterize ancestral proteins

  • Compare function of ancestral and extant proteins

  • Identify key mutations that altered function

Ecological Correlation Analysis:

  • Map CASP-like protein diversity to ecological niches

  • Correlate sequence variations with environmental factors

  • Analyze adaptations in species with specialized barrier requirements

  • Compare domesticated crops with wild ancestors

By integrating these evolutionary approaches, researchers can develop testable hypotheses about which aspects of Sb03g033320 function are ancestral, which are derived adaptations, and which features might be manipulated to enhance desired traits in crop improvement programs.

What emerging technologies hold promise for advancing our understanding of Sb03g033320?

Several cutting-edge technologies are poised to revolutionize research on Sb03g033320 and related CASP-like proteins, offering unprecedented insights into their structure, function, and regulation:

Advanced Imaging Technologies:

  • Cryo-Electron Tomography: For visualizing Sb03g033320 in its native membrane environment

  • Super-Resolution Live Cell Imaging: To track protein dynamics during barrier formation

  • Correlative Light and Electron Microscopy (CLEM): For connecting protein localization with ultrastructural features

  • Expansion Microscopy: For nanoscale resolution of protein organization in plant cell walls

Single-Cell and Spatial Omics:

  • Single-Cell RNA-Seq: To resolve cell-type specific expression patterns

  • Spatial Transcriptomics: For mapping expression patterns with tissue context

  • Single-Cell Proteomics: To detect cell-specific protein accumulation

  • Spatial Metabolomics: To correlate barrier formation with metabolite distributions

Genome Editing Advances:

  • Base Editing: For precise modification of specific amino acids

  • Prime Editing: For targeted sequence replacements without double-strand breaks

  • Multiplexed CRISPR Systems: For simultaneous modification of multiple CASP-like genes

  • Inducible CRISPR Systems: For temporal control of gene modification

Structural Biology Breakthroughs:

  • Microcrystal Electron Diffraction: For membrane protein structure determination

  • AlphaFold-Empowered Structure Prediction: For accurate computational models

  • Hydrogen-Deuterium Exchange Mass Spectrometry: For probing dynamic structural changes

  • Time-Resolved Structural Methods: For capturing conformational changes during function

Systems Biology Integration:

  • Multi-Omics Data Integration: For holistic understanding of barrier formation

  • Machine Learning Approaches: To identify patterns in complex datasets

  • Digital Twin Modeling: For predictive simulation of barrier responses

  • Network Perturbation Analysis: To map system-wide effects of Sb03g033320 alterations

By strategically applying these emerging technologies, researchers can address previously intractable questions about Sb03g033320, potentially leading to breakthroughs in understanding how plants form protective barriers and how these mechanisms might be enhanced for agricultural applications.

What are the most significant unanswered questions about Sb03g033320 and how might they be addressed?

Despite progress in understanding CASP-like proteins, several critical questions about Sb03g033320 remain unanswered, representing important frontiers for future research:

Fundamental Questions and Research Approaches:

  • Structural Organization Question:
    Q: How does Sb03g033320 organize spatially to facilitate lignin deposition?
    Approach: Combine super-resolution microscopy with proximity labeling techniques to map the spatial organization of Sb03g033320 during barrier formation

  • Regulatory Mechanism Question:
    Q: What signaling pathways regulate Sb03g033320 expression and activity during pathogen attack?
    Approach: Phosphoproteomics combined with targeted mutagenesis of potential regulatory sites and pathogen challenge experiments

  • Interaction Network Question:
    Q: What is the complete interactome of Sb03g033320 during barrier formation?
    Approach: BioID or APEX2 proximity labeling coupled with mass spectrometry to identify proteins in close proximity to Sb03g033320 during stress responses

  • Functional Diversification Question:
    Q: How has Sb03g033320 function diversified compared to other CASP-like proteins in sorghum?
    Approach: Comparative phenotyping of multiple CASP-like protein mutants and creation of higher-order mutants to assess functional redundancy and specialization

  • Environmental Adaptation Question:
    Q: How does Sb03g033320 function respond to combined biotic and abiotic stresses?
    Approach: Factorial experimental design exposing plants to combinations of pathogen challenge and abiotic stresses with multi-omics analysis

Methodological Innovations Required:

Research QuestionTechnical ChallengeProposed Innovation
Temporal dynamics of barrier formationCapturing rapid responsesReal-time biosensors for lignin polymerization
Membrane domain organizationVisualizing nanoscale assembliesExpansion microscopy combined with super-resolution
Protein-lignin interactionsDirect measurement of interactionsDevelopment of lignin-specific probes for in vivo studies
Tissue-specific functionsCell-type resolution in complex tissuesSingle-cell multi-omics in plant tissues

Interdisciplinary Collaboration Framework:

  • Plant pathologists and biochemists for stress response mechanisms

  • Structural biologists for protein organization principles

  • Computational biologists for systems-level integration

  • Synthetic biologists for engineered barrier systems

  • Crop scientists for translational applications

By addressing these fundamental questions through innovative approaches and interdisciplinary collaboration, researchers can develop a comprehensive understanding of Sb03g033320 function that bridges molecular mechanisms to whole-plant phenotypes and agricultural applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.