Recombinant Sorghum bicolor CASP-like protein Sb04g002820 (Sb04g002820)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Classification

Gene designation:

  • Primary locus: Sb04g002820 (Sorghum bicolor)

  • Synonyms: SORBIDRAFT_04g002820, SbCASPL4A1, hypothetical protein SORBIDRAFT_04g002820

Protein features:

  • UniProt ID: C5XTX2

  • Sequence length: 452 amino acids (full-length)

  • Domains: Four transmembrane helices typical of CASPL family proteins

Recombinant Expression Systems

The protein has been produced using multiple heterologous systems:

ParameterCell-Free Expression E. coli Expression
HostCell-free lysateEscherichia coli
Purity≥85% (SDS-PAGE)Not specified
Storage-20°C (50% glycerol buffer)-20°C/-80°C
Expression regionFull-length (1–452 aa)Full-length (1–452 aa)

Partial variants (e.g., truncated forms) are also available in yeast, baculovirus, or mammalian cell systems .

Membrane scaffolding

  • CASPL proteins form stable plasma membrane domains that act as diffusion barriers, analogous to CASP proteins in endodermal cells .

  • Sb04g002820 integrates into CASP-like scaffolds when expressed ectopically, suggesting shared structural properties with CASPs .

Stress response modulation

  • Orthologs like Arabidopsis thaliana AtCASPL4C1 regulate cold tolerance:

    • Knockouts exhibit accelerated growth and increased biomass under normal conditions .

    • Overexpression enhances cold sensitivity, while knockouts show improved cold resilience .

Evolutionary conservation

  • CASPLs are present in land plants and green algae, with homologs in the MARVEL protein family outside Plantae .

Key studies:

  1. Membrane domain engineering

    • CASPLs recruit lignin-polymerizing peroxidases to modify adjacent cell walls, a mechanism conserved across vascular plants .

    • Deletion of extracellular loops does not disrupt scaffold formation, indicating transmembrane helices drive domain assembly .

  2. Phenotypic impacts of CASPL manipulation

    • Arabidopsis AtCASPL4C1 knockouts show:

      • 20–30% increased dry weight compared to wild types .

      • Earlier flowering and altered transcript levels of CASP1–5 genes .

    • No significant disruption of Casparian strip lignin deposition in roots, suggesting functional divergence from core CASPs .

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please contact your local distributor.
Note: All proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is selected during production. If you require a specific tag, please inform us and we will prioritize its development.
Synonyms
Sb04g002820; CASP-like protein 4A1; SbCASPL4A1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-452
Protein Length
full length protein
Species
Sorghum bicolor (Sorghum) (Sorghum vulgare)
Target Names
Sb04g002820
Target Protein Sequence
MGLRDSLKEREDRRSSEEEGDARQSWMTRESTTGWRKESTAALGTPVADWQCVLLLQFGA LQQKLLKAFPRAGPRPTTTLVPARPERARKKPHSQPPPSTHMALQAQATASPSPSPSPTR GRTGSGEWPDDAEKLPIAATASPARSSDAVELVVVASTRHAAAAKYVPRRSTSHTADPNP GRGGGGGSAGWYSWNGGRTRTAAPPRHARADPPPAPPRRQQPVEAPPPPPPPPPPPAPAP ALPPPVPPSPPAPAQAPVPPSATAPAPAPVPAPRASSPHVQFRSADQVVPNILSRKRRAA AMQRTALLARGAAAGLCLAALAVLAADTRKGWARDSYSNYTQFRYSEAVNVIGFIYSVFQ FVALVELMRRNKHLIPHPKRDLFDFTMDQVLTYLLISSSSSATARVSDLIDNWGSDPFPS MANGSIAISFLAFAVFAICSLISAYNLFRRDV
Uniprot No.

Target Background

Database Links

KEGG: sbi:8057526

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the fundamental function of CASP-like proteins in Sorghum bicolor?

    CASP-like proteins in Sorghum bicolor, including Sb04g002820, are believed to serve multiple functions:

    • Formation of membrane scaffolds in specialized cell domains

    • Directing cell wall modifications, particularly lignin deposition

    • Contribution to barrier formation in root tissues

    • Potential involvement in abiotic stress responses

    Based on studies of CASP proteins in other plant species, these proteins initially localize to the plasma membrane before becoming concentrated at specific membrane domains. In Arabidopsis, CASP proteins form a membrane fence in the endodermis and show extremely low turnover once localized to their target domain . The primary function appears to be creating diffusion barriers and directing the modification of adjacent cell walls through interactions with secreted enzymes like peroxidases .

  • How do CASP-like proteins contribute to plant development in Sorghum bicolor?

    CASP-like proteins contribute to sorghum development through several mechanisms:

    • Root barrier formation: Similar to other plants, they likely contribute to the formation of Casparian strips in the endodermis, creating barriers that control nutrient and water uptake

    • Selective permeability: They help establish plasma membrane domains that prevent lateral diffusion of specific membrane proteins and lipids

    • Cell wall modification: They direct the deposition of lignin in specific cell wall regions, affecting tissue development and mechanical properties

    • Stress adaptation: Some CASP-like proteins appear to be involved in responses to environmental stresses, as seen in studies of related proteins in other species

    Research on rice OsCASP1 (a CASP protein ortholog) has shown that these proteins influence root development and stress tolerance, suggesting similar roles in sorghum .

Experimental Methods and Protocols

  • What are the optimal conditions for handling recombinant Sb04g002820 protein in laboratory settings?

    For optimal handling of recombinant Sb04g002820:

    ParameterRecommended ConditionNotes
    Storage temperature-20°CFor extended storage, -80°C is recommended
    Working storage4°CMaximum 1 week
    Buffer compositionTris-based buffer with 50% glycerolOptimized for protein stability
    Freeze-thaw cyclesMinimizeRepeated freezing and thawing should be avoided
    FormLiquid containing glycerolAs supplied by manufacturers

    The protein is typically expressed in E. coli as the host system . When working with the protein, it's advisable to make small aliquots to avoid repeated freeze-thaw cycles, which can lead to denaturation and loss of activity .

  • What expression systems and purification strategies are most effective for producing functional recombinant Sb04g002820?

    Based on available data, the most effective expression and purification approach includes:

    1. Expression system: E. coli is the predominant host system used for recombinant Sb04g002820 production . The bacterial system allows for high yield and relatively straightforward purification.

    2. Vector design:

      • Include a tag system (though tag type may vary based on experimental needs)

      • Use full expression region (1-452 amino acids)

      • Consider codon optimization for E. coli if expression levels are low

    3. Purification strategy:

      • Affinity chromatography based on the fusion tag

      • Size exclusion chromatography for further purification

      • Buffer exchange to a Tris-based buffer with 50% glycerol for final storage

    4. Quality control:

      • SDS-PAGE to verify size and purity

      • Western blot for identity confirmation

      • Mass spectrometry for sequence verification

    The specific tag system is often determined during the production process to optimize for each protein batch .

  • What techniques are most effective for studying CASP-like protein localization and dynamics in plant cells?

    For studying CASP-like protein localization and dynamics:

    1. Fluorescent protein fusion approaches:

      • GFP tagging for in vivo localization studies

      • Transient expression systems using Agrobacterium-mediated transformation

      • Stable transformation for long-term studies

    2. Microscopy techniques:

      • Confocal laser scanning microscopy for high-resolution imaging

      • Time-lapse imaging for dynamics studies

      • Fluorescence recovery after photobleaching (FRAP) to study protein turnover

    3. Cellular fractionation:

      • Plasma membrane isolation followed by western blotting

      • Membrane domain isolation techniques

    4. Immunolocalization:

      • Immunostaining with specific antibodies

      • Electron microscopy with immunogold labeling

    Studies in rice have utilized GUS reporter systems to analyze tissue-specific expression patterns of CASP proteins, while Arabidopsis studies have employed fluorescent protein fusions to track CASP dynamics . Similar approaches would be applicable to Sb04g002820. Caution is needed with immunostaining approaches, as appropriate negative controls are essential for accurate interpretation .

Advanced Research Questions

  • How does Sb04g002820 compare functionally with CASP-like proteins in other plant species?

    Comparative analysis of Sb04g002820 with CASP-like proteins in other species reveals both similarities and differences:

    SpeciesProteinSimilaritiesDifferencesReference
    Rice (Oryza sativa)OsCASP1Membrane localization, involvement in cell wall modificationOsCASP1 shows strong expression in small lateral root tips and stele; induced by salt stress
    Arabidopsis thalianaAtCASP1-5Four-transmembrane structure, role in membrane domain formationAtCASPs form a protein scaffold specifically at the Casparian strip domain
    Watermelon (Citrullus lanatus)ClCASPLPlasma membrane localizationCold-induced expression, negative regulation of cold tolerance

    While CASP-like proteins across species share the common function of membrane domain organization and cell wall modification, their specific expression patterns, stress responses, and developmental roles appear to vary. For instance, ClCASPL negatively affects cold tolerance, whereas Arabidopsis CASPL4C1 (AtCASPL4C1) mutants show enhanced cold tolerance . The sorghum Sb04g002820 appears to share structural features with these proteins but may have evolved specific functions adapted to sorghum's environmental challenges .

  • What critical domains and amino acid residues in Sb04g002820 are essential for its function?

    Based on studies of CASP proteins in Arabidopsis, several key domains and residues in Sb04g002820 are likely critical for function:

    1. Transmembrane domains: The four transmembrane regions are essential for proper membrane insertion and localization.

    2. Conserved residues in extracellular loop 2 (EL2):

      • Studies in Arabidopsis identified several conserved amino acids in EL2 that affect protein localization

      • Mutations in residues shared among most CASP-like proteins affected localization:

        • Cysteine residues (corresponding to C168 and C175 in Arabidopsis)

        • Phenylalanine (F174 in Arabidopsis)

        • Glycine (G158 in Arabidopsis)

        • Tryptophan (W164 in Arabidopsis showed the strongest effect)

    3. C-terminal domain: Likely involved in protein-protein interactions based on studies of related proteins.

    The tryptophan residue appears particularly critical, as its mutation in Arabidopsis resulted in exclusion from the Casparian strip domain and near-undetectable protein levels . Homologous residues in Sb04g002820 would likely serve similar functions, though specific mutagenesis studies on the sorghum protein would be needed to confirm.

  • How might genetic modification of Sb04g002820 affect sorghum's stress tolerance and development?

    Based on studies of related proteins in other plants, genetic modification of Sb04g002820 could have several potential effects:

    1. Altered root barrier function:

      • Knockout or downregulation might disrupt Casparian strip formation

      • This could lead to altered mineral nutrient uptake and water movement

      • Potential increased sensitivity to soil-based stresses

    2. Modified stress responses:

      • Studies of related proteins suggest potential impacts on stress tolerance

      • In watermelon, CASPL protein negatively regulates cold tolerance

      • In rice, OsCASP1 mutation affects salt stress tolerance

    3. Growth and development changes:

      • AtCASPL4C1 knockout plants showed altered growth dynamics, faster growth, increased biomass, and earlier flowering

      • Similar phenotypic changes might occur in sorghum with Sb04g002820 modification

    4. Cell wall composition changes:

      • Potential alterations in lignin deposition patterns

      • This could affect biofuel potential, as seen in other sorghum genetic modifications targeting lignin

    The specific outcomes would depend on whether the gene is knocked out, downregulated, or overexpressed. Research on a cold-induced CASP-like protein in watermelon showed that overexpression increased cold sensitivity, while knockout increased tolerance , suggesting complex regulatory roles.

  • How does Sb04g002820 interact with lignin biosynthesis pathways in sorghum?

    The interaction between Sb04g002820 and lignin biosynthesis likely involves:

    1. Spatial coordination of lignin deposition:

      • CASP proteins in Arabidopsis direct the deposition of lignin in cell walls adjacent to their membrane domain

      • This occurs through interactions with secreted peroxidases

      • Sb04g002820 likely performs a similar scaffolding function in sorghum

    2. Enzyme recruitment:

      • CASP proteins interact with peroxidases involved in lignin polymerization

      • In Arabidopsis, this interaction can occur outside the Casparian strip domain when CASPs are ectopically expressed

    3. Relationship with key lignin biosynthesis enzymes:

      • Sorghum lignin biosynthesis involves enzymes like 4-coumarate:CoA ligase (4CL)

      • Recent research has shown that modifying 4CL expression can reduce lignin content by up to 25% in sorghum

      • The relationship between CASP-like proteins and these enzymes remains to be fully characterized

    4. Integration with plant development:

      • Lignin deposition patterns in sorghum differ from those in Arabidopsis

      • CASP-like proteins may have evolved unique functions in sorghum to coordinate lignin deposition in species-specific patterns

    This interaction is particularly important for sorghum as a biofuel crop, where lignin content and composition significantly impact biomass extractability . Understanding how Sb04g002820 influences lignin deposition could provide targets for improving sorghum as a bioenergy feedstock.

Data Analysis and Research Methodology

  • What bioinformatic approaches are most valuable for analyzing CASP-like protein evolution and function?

    Several bioinformatic approaches are particularly valuable for analyzing CASP-like proteins:

    1. Phylogenetic analysis:

      • Multiple sequence alignment of CASP-like proteins across species

      • Construction of phylogenetic trees to infer evolutionary relationships

      • Analysis of selection pressure on different domains

    2. Protein domain prediction:

      • Transmembrane domain prediction using tools like TMHMM or Phobius

      • Identification of conserved motifs using MEME or similar tools

      • Secondary structure prediction using PSIPRED

    3. Gene expression analysis:

      • Mining of transcriptome data to identify expression patterns

      • Sorghum transcriptome atlas data is particularly valuable

      • Co-expression network analysis to identify functional associations

    4. Promoter analysis:

      • Identification of cis-regulatory elements in promoter regions

      • Comparison with stress-responsive elements in other CASP genes

      • Prediction of transcription factor binding sites

    5. Structural modeling:

      • Homology modeling based on related proteins

      • Molecular dynamics simulations to predict protein behavior

      • Protein-protein interaction surface prediction

    The sorghum reference genome and its improved assembly provide a valuable resource for these analyses, allowing integration of genomic, transcriptomic, and functional data.

  • How can contradictory findings about CASP protein function across different plant species be reconciled?

    Reconciling contradictory findings about CASP proteins requires:

    1. Accounting for evolutionary divergence:

      • CASP-like proteins may have undergone functional diversification

      • Species-specific adaptations may result in different functions

      • Phylogenetic analysis can help identify when functional divergence occurred

    2. Considering methodological differences:

      • Different experimental approaches may yield apparently contradictory results

      • For example, different staining methods for Casparian strips reveal different patterns

      • PI (propidium iodide) permeability tests work differently in Arabidopsis and rice

    3. Recognizing context-dependent functions:

      • The same protein may have different functions in different tissues or conditions

      • CASP-like proteins appear to have roles beyond Casparian strip formation

      • Expression pattern differences may explain functional differences

    4. Resolving technical issues:

      • Some contradictions arise from technical limitations

      • For instance, lack of proper negative controls in immunostaining led to conflicting results in rice

      • Standardized methodologies across studies would reduce such contradictions

    5. Integrating multiple data types:

      • Combining genetic, biochemical, and cell biological approaches

      • Using CRISPR-based approaches for precise genetic manipulation

      • Employing advanced imaging techniques for detailed localization studies

    A comprehensive approach that considers evolutionary context, uses multiple complementary techniques, and carefully controls for technical variables is essential for reconciling contradictory findings.

  • What quantitative methods are most reliable for measuring CASP protein interactions and localization?

    For reliable quantification of CASP protein interactions and localization:

    1. Fluorescence-based interaction assays:

      • Förster Resonance Energy Transfer (FRET) for protein-protein interactions

      • Bimolecular Fluorescence Complementation (BiFC) for in vivo interaction validation

      • Fluorescence Correlation Spectroscopy (FCS) for dynamics and concentration

    2. Localization quantification:

      • Fluorescence intensity profile analysis across cell membranes

      • Colocalization analysis using Pearson's or Mander's coefficients

      • Time-lapse quantification of protein recruitment and removal

    3. Biochemical interaction quantification:

      • Co-immunoprecipitation followed by mass spectrometry (quantitative proteomics)

      • Surface Plasmon Resonance (SPR) for interaction kinetics

      • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

    4. Advanced microscopy approaches:

      • Super-resolution microscopy (STORM, PALM) for nanoscale localization

      • Fluorescence Recovery After Photobleaching (FRAP) for protein dynamics

      • Single-molecule tracking for movement and interaction analysis

    5. Data analysis frameworks:

      • Machine learning approaches for pattern recognition in localization data

      • Computational modeling of protein dynamics

      • Statistical approaches for comparing localization under different conditions

    Studies in Arabidopsis have used fluorescent protein fusions to track CASP dynamics and localization patterns . Similar approaches, combined with quantitative image analysis, would be valuable for studying Sb04g002820 interactions and localization in sorghum.

  • What experimental designs are most effective for characterizing the role of Sb04g002820 in abiotic stress responses?

    Effective experimental designs for characterizing Sb04g002820's role in stress responses include:

    1. Genetic manipulation approaches:

      • CRISPR/Cas9-mediated gene knockout

      • RNAi-based gene silencing (similar to approaches used for other sorghum genes )

      • Overexpression studies using constitutive or inducible promoters

    2. Stress treatment protocols:

      • Controlled application of individual stresses (drought, salt, heat, cold)

      • Combined stress treatments to mimic field conditions

      • Temporal analysis to capture early and late responses

    3. Expression analysis:

      • Tissue-specific RT-qPCR to quantify expression changes under stress

      • RNA-seq for genome-wide expression context

      • Promoter-reporter fusions to visualize expression patterns

    4. Physiological measurements:

      • Root barrier function tests (e.g., ion uptake assays)

      • Water use efficiency measurements

      • Nutrient content analysis

    5. Cellular and subcellular analyses:

      • Histochemical staining for lignin deposition patterns

      • Immunolocalization to track protein redistribution under stress

      • Live-cell imaging with fluorescent protein fusions

    6. Field-based validation:

      • Testing transgenic lines under natural conditions

      • Multi-location trials to assess genotype × environment interactions

      • Yield and biomass quality assessments

    Studies of related proteins have shown that expression analysis across multiple tissues and stress conditions provides valuable insights into functional roles . A similar comprehensive approach would be valuable for Sb04g002820.

  • How can high-throughput phenotyping be integrated with molecular studies of Sb04g002820 for crop improvement applications?

    Integration of high-throughput phenotyping with molecular studies can be achieved through:

    1. Phenomics platforms:

      • Automated imaging systems to track growth parameters

      • Spectral imaging for physiological status assessment

      • Root phenotyping systems to capture below-ground traits

    2. Multi-omics integration:

      • Correlating Sb04g002820 expression with transcriptome, proteome, and metabolome data

      • Identifying molecular markers associated with phenotypic variations

      • Network analysis to place Sb04g002820 in broader regulatory contexts

    3. Genetic diversity screening:

      • Analyze natural variation in Sb04g002820 across sorghum germplasm

      • Association studies linking sequence variants to phenotypic traits

      • Leveraging the extensive genetic diversity in sorghum

    4. Targeted breeding approaches:

      • Marker-assisted selection based on favorable Sb04g002820 alleles

      • CRISPR-based gene editing for precise trait modification

      • Pyramiding of multiple beneficial alleles

    5. Field-to-lab-to-field pipeline:

      • Initial field phenotyping to identify promising traits

      • Laboratory validation of molecular mechanisms

      • Field testing of improved lines under multiple environments

    6. Data management and analysis frameworks:

      • Machine learning approaches for phenotype prediction

      • Statistical models for genotype-phenotype associations

      • Data visualization tools for complex multi-dimensional datasets

    Recent genome-wide association studies in sorghum have identified marker-trait associations for various agronomic traits , and similar approaches could be used to explore the relationship between Sb04g002820 variants and stress tolerance traits.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.