Recombinant Sorghum bicolor CASP-like protein Sb04g005230 (Sb04g005230)

Shipped with Ice Packs
In Stock

Description

Production and Recombinant Expression

The commercial recombinant version of Sb04g005230 is produced through heterologous expression in Escherichia coli, a common host for protein production. The recombinant protein features an N-terminal His-tag, which facilitates purification through affinity chromatography . This production method yields protein with purity greater than 90% as determined by SDS-PAGE analysis.

The recombinant expression system provides several advantages for research applications:

  1. High yield of purified protein

  2. Consistent quality across production batches

  3. Addition of fusion tags (His-tag) that enable easy detection and purification

  4. Production of functional protein independent of plant growth conditions

The final product is typically provided as a lyophilized powder, which offers stability during shipping and storage .

Expression Patterns and Regulation

Based on studies of orthologous proteins, CASP-like proteins show specific expression patterns that provide clues to their function. In Arabidopsis, the orthologous AtCASPL4C1 is widely expressed in various organs and is inducible by cold temperatures . This expression pattern differs from the more restricted expression of the five canonical CASP genes (CASP1-5), which are primarily expressed in the root endodermis.

If Sb04g005230 follows similar patterns as its orthologues, it may be expressed in multiple tissues throughout the plant and potentially regulated by environmental factors such as temperature. The cold-inducible nature of related CASP-like genes suggests potential roles in environmental stress responses .

Table 3: Comparative Expression Patterns of CASP-like Proteins in Different Species

SpeciesGeneExpression PatternEnvironmental Regulation
Arabidopsis thalianaAtCASPL4C1Widespread in various organsCold-inducible
Citrullus lanatus (Watermelon)ClCASPLIdentified as cold-induced transcriptUpregulated by cold stress
Sorghum bicolorSb04g005230Potential expression in multiple tissues (predicted)Potential stress responsiveness (predicted)

Potential Research Applications

The recombinant Sb04g005230 protein has several potential applications in plant biology research:

  1. Functional Studies: The purified protein can be used in biochemical assays to determine binding partners, enzymatic activities, or structural properties.

  2. Antibody Production: The recombinant protein can serve as an antigen for generating specific antibodies that can be used in techniques such as immunolocalization, Western blotting, or immunoprecipitation.

  3. Protein-Protein Interaction Studies: Using techniques such as pull-down assays or yeast two-hybrid screens to identify proteins that interact with Sb04g005230.

  4. Structure Determination: The purified protein could be used for crystallization and subsequent structural analysis.

  5. Comparative Studies: Research comparing the properties of CASP-like proteins across different plant species could provide insights into their evolutionary significance and functional diversification.

  6. Agricultural Applications: Understanding the role of Sb04g005230 in stress responses could potentially contribute to the development of more resilient crop varieties.

Future Research Directions

Several promising avenues for future research on Sb04g005230 emerge from existing knowledge of CASP-like proteins:

  1. Functional Characterization: Determining the precise biological function of Sb04g005230 in Sorghum bicolor through gene knockout or overexpression studies.

  2. Subcellular Localization: Confirming the plasma membrane localization using fluorescent protein fusions and microscopy techniques.

  3. Role in Stress Responses: Investigating potential roles in drought tolerance, which is a characteristic feature of Sorghum bicolor.

  4. Comparative Genomics: Exploring the evolution of CASP-like proteins across grass species and their potential adaptation to different environmental conditions.

  5. Structural Studies: Determining the three-dimensional structure of the protein to better understand its function at the molecular level.

  6. Agricultural Applications: Exploring the potential for manipulating Sb04g005230 expression to enhance crop resilience to environmental stresses.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
Sb04g005230; CASP-like protein 2C2; SbCASPL2C2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-194
Protein Length
full length protein
Species
Sorghum bicolor (Sorghum) (Sorghum vulgare)
Target Names
Sb04g005230
Target Protein Sequence
MAAGQPRPPPPPSSVRTERVLRAACAAMAAAGALLLGFSAETKTVIFVQKKAVPKDVQAL WVLIVAAAAAAAYHAAQLARCLCMDRLAGGGGGCRRLRRAVACATFLLDKGCAYMVLATT VAALQACFVGLLGVEALQWSKLCNIYTRFCEQAAAGMVCSLVAAAGMAVLSAFSARDLFR RRRPCSPCVQVQQV
Uniprot No.

Target Background

Database Links

KEGG: sbi:8079392

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does Sb04g005230 relate to other CASP-like proteins in plants?

CASP-like proteins belong to a family of Casparian strip membrane domain proteins that are typically involved in forming diffusion barriers in plant tissues. While the search results don't specifically detail the evolutionary relationships of Sb04g005230 to other CASP-like proteins, the Sorghum bicolor genome has been extensively annotated with 34,211 genes identified . Phylogenetic analysis would typically be performed using multiple sequence alignment tools to determine the relationship of Sb04g005230 to other CASP family members both within Sorghum bicolor and across other plant species.

The protein likely shares structural and functional similarities with other CASP-like proteins that form part of the plant extracellular matrix and participate in cell wall organization. To determine specific relationships, researchers should conduct comprehensive phylogenetic analyses using the amino acid sequence provided and compare it against databases such as NCBI and UniProt.

What is the predicted subcellular localization of Sb04g005230?

Based on the amino acid sequence characteristics, Sb04g005230 likely localizes to membranes. The search results don't explicitly state the subcellular localization, but analysis of the sequence shows multiple hydrophobic regions suggesting transmembrane domains . CASP family proteins typically localize to the plasma membrane, particularly in specialized membrane domains.

Researchers investigating the localization experimentally should consider:

  • Fluorescent protein fusion constructs (GFP, YFP, etc.) for live-cell imaging

  • Immunolocalization with antibodies against the His-tag or the protein itself

  • Subcellular fractionation followed by Western blotting

  • Predictive bioinformatic tools such as TargetP, PSORT, or DeepLoc

What are the optimal conditions for expression of recombinant Sb04g005230?

The recombinant Sb04g005230 protein is typically expressed in E. coli expression systems . The search results indicate that the full-length protein (amino acids 1-194) is fused to an N-terminal His-tag to facilitate purification . While specific expression conditions are not detailed in the search results, standard protocols for optimal expression of plant proteins in E. coli would include:

  • Selection of an appropriate E. coli strain (BL21(DE3), Rosetta, or other strains optimized for recombinant protein expression)

  • Optimization of induction conditions:

    • IPTG concentration (typically 0.1-1.0 mM)

    • Induction temperature (often lowered to 16-25°C to enhance solubility)

    • Induction duration (4-24 hours)

  • Consideration of specialized media formulations to enhance yield

  • Co-expression with chaperones if protein folding is problematic

Researchers should perform small-scale expression tests varying these parameters before scaling up to production levels.

What are the recommended storage and handling procedures for recombinant Sb04g005230?

According to the product information, recombinant Sb04g005230 is supplied as a lyophilized powder . For optimal stability and activity:

  • Storage conditions:

    • Store at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (recommended default is 50%)

    • Aliquot for long-term storage at -20°C/-80°C

  • Buffer conditions:

    • The protein is supplied in a Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    • Another source indicates a Tris-based buffer with 50% glycerol, optimized for this specific protein

Researchers should avoid repeated freeze-thaw cycles as they can lead to protein denaturation and loss of activity .

What analytical methods are recommended for validating recombinant Sb04g005230 purity and integrity?

To validate the purity and integrity of recombinant Sb04g005230, researchers should employ multiple analytical approaches:

  • SDS-PAGE:

    • The product information indicates purity greater than 90% as determined by SDS-PAGE

    • Expected molecular weight would be approximately 21-22 kDa (194 amino acids plus His-tag)

    • Both reducing and non-reducing conditions should be tested to assess potential disulfide bonding

  • Western blotting:

    • Using anti-His antibodies to detect the N-terminal His-tag

    • Using specific antibodies against Sb04g005230 if available

  • Mass spectrometry:

    • MALDI-TOF or ESI-MS to confirm molecular weight

    • Peptide mass fingerprinting after tryptic digestion to confirm sequence identity

  • Functional assays:

    • Based on predicted function (membrane association, protein-protein interactions)

    • Binding assays with predicted interaction partners

  • Circular dichroism (CD) spectroscopy:

    • To assess secondary structure and proper folding

How can Sb04g005230 be utilized in stress response studies in Sorghum bicolor?

Sorghum bicolor is known for its drought tolerance and adaptation to various environmental stresses . The search results indicate that certain proline-rich proteins (PRPs) and hybrid proline-rich proteins (HyPRPs) in Sorghum bicolor respond to various abiotic stresses including drought, salt, heat, cold, ABA exposure, and zinc stress . While the search results don't specifically mention Sb04g005230 in this context, CASP-like proteins are often involved in stress responses in plants.

Researchers could design experiments to investigate Sb04g005230's role in stress response:

  • Expression analysis:

    • qRT-PCR to quantify Sb04g005230 gene expression under various stress conditions

    • Western blotting to assess protein levels using anti-His antibodies or specific antibodies

    • Proteomics approaches to study post-translational modifications under stress

  • Functional studies:

    • Overexpression or knockdown/knockout of Sb04g005230 in Sorghum or model plants

    • Phenotypic analysis of transgenic plants under various stress conditions

    • Complementation studies in mutant lines

  • Interaction studies:

    • Using recombinant Sb04g005230 to identify interaction partners under normal and stress conditions

    • Co-immunoprecipitation experiments

    • Yeast two-hybrid or split-ubiquitin assays for membrane proteins

What considerations should be made when designing protein-protein interaction studies with Sb04g005230?

When investigating protein-protein interactions involving Sb04g005230, researchers should consider its likely membrane-associated nature and design experiments accordingly:

  • Selection of appropriate interaction detection methods:

    • Split-ubiquitin system (specifically designed for membrane proteins)

    • Membrane yeast two-hybrid (MYTH) system

    • Bimolecular fluorescence complementation (BiFC) in planta

    • Co-immunoprecipitation with detergent-solubilized membranes

    • Surface plasmon resonance (SPR) with the purified recombinant protein

  • Control experiments:

    • Non-interacting protein pairs as negative controls

    • Known interacting protein pairs as positive controls

    • Testing interaction specificity through mutagenesis of key residues

  • Consideration of protein orientation:

    • N-terminal vs. C-terminal fusion tags can affect interaction detection

    • For membrane proteins, proper orientation relative to the membrane is critical

  • Validation in multiple systems:

    • In vitro pull-down assays with recombinant proteins

    • In vivo co-localization and co-immunoprecipitation

    • Functional validation of interactions through genetic approaches

What experimental design principles should be followed when studying the role of Sb04g005230 in plant development?

To investigate the role of Sb04g005230 in plant development, researchers should employ a comprehensive experimental approach:

  • Spatiotemporal expression analysis:

    • Utilize transcriptome data from different tissues and developmental stages

    • The Sorghum bicolor transcriptome atlas described in the search results includes 47 RNA-seq profiles from various plant organs and developmental phases

    • Develop reporter gene fusions (e.g., promoter::GUS constructs) to visualize expression patterns

  • Genetic manipulation strategies:

    • CRISPR/Cas9-mediated gene editing to generate knockout mutants

    • RNAi or antisense approaches for knockdown

    • Overexpression under constitutive or inducible promoters

    • Tissue-specific expression modulation

  • Phenotypic characterization:

    • Systematic analysis of growth parameters

    • Microscopic examination of cellular organization, particularly in tissues where CASP-like proteins typically function

    • Physiological measurements relevant to potential function

  • Statistical design considerations:

    • Appropriate randomization and blocking in experimental design

    • Sufficient biological and technical replicates (minimum n=3, preferably more)

    • Power analysis to determine sample size requirements

    • Analysis using appropriate statistical methods, considering parametric vs. non-parametric approaches based on data distribution

What statistical approaches are most appropriate for analyzing experimental data involving Sb04g005230?

When analyzing data from experiments involving Sb04g005230, researchers should select statistical methods appropriate to their experimental design and data characteristics:

  • For expression analysis data:

    • Normalization methods for qRT-PCR data (reference genes should be validated)

    • Statistical comparisons using t-tests (for two conditions) or ANOVA (for multiple conditions)

    • Post-hoc tests (e.g., Tukey's HSD) for multiple comparisons when using ANOVA

    • Non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) if data violate normality assumptions

  • For phenotypic data:

    • Descriptive statistics (mean, median, standard deviation, standard error)

    • Inferential statistics considering the experimental design (nested, factorial, etc.)

    • Mixed models for repeated measures or split-plot designs

    • Appropriate transformation of data if necessary to meet parametric test assumptions

  • For protein-protein interaction data:

    • Statistical assessment of binding affinities

    • Multiple testing correction for large-scale interaction screens

    • Network analysis approaches for complex interaction datasets

  • General considerations:

    • Effect size calculation to quantify magnitude of differences

    • Statistical power analysis to ensure adequate sample sizes

    • Consideration of Type I and Type II errors in hypothesis testing

    • Meta-analysis approaches when integrating multiple datasets

How should researchers interpret conflicting data regarding Sb04g005230 function?

When faced with conflicting data regarding Sb04g005230 function, researchers should:

  • Systematically evaluate experimental differences:

    • Different experimental systems (in vitro vs. in vivo, different expression systems)

    • Variations in protein constructs (full-length vs. truncated, different tags)

    • Differences in experimental conditions (temperature, pH, buffer composition)

    • Biological context (tissue type, developmental stage, stress conditions)

  • Apply critical analysis principles:

    • Assess methodological rigor of conflicting studies

    • Consider statistical power and significance

    • Evaluate biological vs. statistical significance of observed differences

    • Examine potential confounding variables

  • Design reconciliation experiments:

    • Replicate key experiments under standardized conditions

    • Test specific hypotheses that might explain discrepancies

    • Employ orthogonal experimental approaches

    • Consider collaborative efforts with laboratories reporting conflicting results

  • Integrate multiple data types:

    • Compare results from different methodological approaches

    • Consider evolutionary conservation of function across species

    • Develop models that might explain conditional functionality

What bioinformatic resources are available for analyzing Sb04g005230 in the context of the Sorghum bicolor genome?

Researchers studying Sb04g005230 can utilize several bioinformatic resources for comprehensive analysis:

  • Genome resources:

    • The improved Sorghum bicolor reference genome described in the search results, which includes 34,211 annotated genes

    • Alignment data from over 50 resequenced genomes from diverse sorghum genotypes, which identified approximately 7.4M SNPs and 1.9M indels

  • Expression databases:

    • The transcriptome atlas of gene expression constructed from 47 RNA-seq profiles of various tissues and developmental stages

    • This resource can help identify co-expressed genes and potential functional networks

  • Comparative genomics tools:

    • Leverage Sorghum bicolor's role as a genetic model for C4 grasses

    • Use the colinearity with other C4 grass genomes to identify functionally conserved elements

  • Protein analysis tools:

    • Structure prediction software to model Sb04g005230 tertiary structure

    • Domain identification tools to characterize functional regions

    • Post-translational modification prediction tools

    • Protein-protein interaction prediction algorithms

  • Functional annotation resources:

    • Gene Ontology (GO) term enrichment analysis

    • Pathway mapping tools like KEGG

    • Ortholog identification across species

These resources collectively provide a robust framework for comprehensive analysis of Sb04g005230's genomic context, evolutionary history, and potential functional roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.