Recombinant Sorghum bicolor CASP-like protein Sb05g019440 (Sb05g019440)

Shipped with Ice Packs
In Stock

Description

Protein Overview

ParameterDetail
Gene NameSb05g019440
Uniprot IDC5Y376
LengthPartial (1-189 amino acids)
Source OrganismSorghum bicolor (Sorghum)
Protein NamesCASP-like protein Sb05g019440

Production Systems

Sb05g019440 is produced in multiple expression systems, each optimized for specific applications:

Host SystemKey FeaturesProduct CodePuritySource
YeastEukaryotic post-translational modificationsCSB-YP510322FJS1>85% (SDS-PAGE)
E. coliHigh-yield bacterial expression; no complex modificationsCSB-EP510322FJS1>85% (SDS-PAGE)
BaculovirusMammalian-like folding; suitable for structural studiesCSB-BP510322FJS1>85% (SDS-PAGE)
Mammalian CellsAuthentic glycosylation and foldingCSB-MP510322FJS1>85% (SDS-PAGE)

Biotinylated Variant:
A biotinylated version (CSB-EP510322FJS1-B) is engineered using AviTag-BirA technology, enabling specific biotinylation for applications like ELISA assays .

Phylogenetic Context

Sb05g019440 aligns with CASPLs, which form a distinct subfamily of CASPs. CASPLs share conserved residues in transmembrane domains but lack the extracellular loop signatures critical for lignin deposition in CASPs .

Experimental Tools

ApplicationDescriptionSource
ELISA KitsQuantify Sb05g019440 levels in plant tissues using recombinant protein standards .
Structural StudiesBaculovirus/mammalian cell-expressed versions enable NMR/X-ray crystallography .

Physicochemical Properties

PropertyValueSource
Molecular Weight~16,092–20,747 Da (estimated for CASPLs)
Theoretical pI~4.2–10.0
Instability Index<40 (stable protein)
HydropathicityVariable (hydrophobic/hydrophilic regions)

Research Gaps and Future Directions

  1. Functional Specificity: Sb05g019440’s role in Sorghum remains uncharacterized. Comparative studies with AtCASPL4C1 could reveal conserved stress-response mechanisms .

  2. Membrane Dynamics: Live-cell imaging of GFP-tagged Sb05g019440 in Sorghum roots could validate its localization and interaction partners.

  3. Agricultural Relevance: CASPLs’ involvement in growth and stress tolerance positions Sb05g019440 as a candidate for improving drought resilience in Sorghum .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on your purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Sb05g019440; CASP-like protein 1U2; SbCASPL1U2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Sorghum bicolor (Sorghum) (Sorghum vulgare)
Target Names
Sb05g019440
Target Protein Sequence
MFGSDDSGCHVMDDDVAPPANGSKAVTLLLRLITLALALTSAVLMATASECTIYGLDGAT ATTVTFKDYQPFIYLVGSNIAATILEVAAIYVQVGKGDDVEDAPMIPRVVLVVVDVAVQM LLYSATGAVFAAVMAYGPQISACTGAAGHFCEQVQRSKIISLAASLSAVLAAVAKDVALP CSVWPHPSS
Uniprot No.

Target Background

Database Links

KEGG: sbi:8064776

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Sb05g019440 and what cellular functions does it perform?

Sb05g019440 is a CASP-like protein found in Sorghum bicolor that functions in the development of apoplastic barriers in the endodermis, specifically Casparian strips and suberin lamellae. These structures are critical for controlling the passage of water and minerals into the plant stele . The protein appears to contribute to salt exclusion mechanisms in salt-excluding plants such as sweet sorghum (Sorghum bicolor) . As a member of the CASP-like protein family, it participates in the biosynthesis and transport of lignin, which is essential for cell wall development and structural integrity . The protein consists of 189 amino acids and contains specific domains that enable it to function in the plant cell membrane and facilitate barrier formation.

How does Sb05g019440 contribute to apoplastic barrier formation?

Sb05g019440, as a CASP-like protein, participates in a complex developmental process of apoplastic barrier formation through several mechanisms:

  • It localizes to the plasma membrane in the endodermal cells, where Casparian strips form

  • It interacts with other proteins to create a scaffold that defines the Casparian strip domain

  • It facilitates the localized deposition of lignin by recruiting enzymes like peroxidases (PERs) and laccases to specific sites on the cell wall

  • It coordinates with the phenylpropanoid pathway proteins, which are responsible for lignin biosynthesis

  • It works in conjunction with fatty acid elongation and ω-hydroxylation pathways that are essential for suberin lamella formation

The protein functions within a developmental sequence where endodermal cells progress from undifferentiated states through developing barriers to mature Casparian strips and suberin lamellae, controlling selective nutrient and water uptake.

What are the recommended protocols for reconstitution and storage of recombinant Sb05g019440?

For optimal performance in experimental procedures, the following protocol is recommended:

  • Reconstitution Procedure:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is recommended by default)

  • Storage Conditions:

    • Store reconstituted working aliquots at 4°C for up to one week

    • For long-term storage, keep at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles as this can compromise protein integrity

    • Lyophilized form has a typical shelf life of 12 months at -20°C/-80°C

    • Liquid form has a typical shelf life of 6 months at -20°C/-80°C

  • Buffer Considerations:

    • The protein is typically supplied in Tris/PBS-based buffer containing 6% Trehalose at pH 8.0

    • This buffer composition helps maintain protein stability during storage and reconstitution

How can researchers effectively design experiments to study Sb05g019440's role in Casparian strip formation?

When designing experiments to investigate Sb05g019440's role in Casparian strip formation, researchers should consider a multi-tiered approach:

  • Developmental Stage Analysis:

    • Collect root samples at different developmental stages (undifferentiated, developing, and mature)

    • Perform histological staining of roots to visualize Casparian strips and suberin lamellae development

    • Use lignin-specific dyes (e.g., berberine) and suberin-specific stains to track barrier formation

  • Gene Expression Profiling:

    • Conduct RNA sequencing on the different developmental sections of roots to correlate gene expression with barrier formation

    • Compare expression levels of Sb05g019440 with related genes involved in the phenylpropanoid pathway, fatty acid elongation, and fatty acid ω-hydroxylation

  • Protein Localization Studies:

    • Use immunohistochemistry with antibodies specific to Sb05g019440

    • Alternatively, create fluorescent protein fusions (GFP-Sb05g019440) for in vivo localization

    • Correlate protein localization with Casparian strip development using confocal microscopy

  • Functional Studies:

    • Develop knockout or knockdown lines (using CRISPR/Cas9 or RNAi) to assess the phenotypic impact

    • Evaluate salt stress responses in mutant vs. wild-type plants to determine functional relevance

    • Complement mutants with the recombinant protein to confirm specificity of observed effects

What analytical techniques are most effective for characterizing Sb05g019440 protein interactions?

Several analytical techniques can be employed to characterize the interactions of Sb05g019440 with other proteins and cellular components:

  • Co-Immunoprecipitation (Co-IP):

    • Utilize the His tag for pull-down assays to identify protein-protein interactions

    • Perform with plant cell extracts to capture native interaction partners

    • Analyze precipitated proteins using mass spectrometry to identify novel binding partners

  • Yeast Two-Hybrid (Y2H) Analysis:

    • Screen for direct protein-protein interactions between Sb05g019440 and candidate proteins

    • Focus on known Casparian strip formation proteins and lignin biosynthesis enzymes

    • Verify positive interactions with alternative methods like BiFC (Bimolecular Fluorescence Complementation)

  • Cross-Linking Studies:

    • Use chemical cross-linkers to stabilize transient protein interactions in vivo

    • Combine with mass spectrometry to identify interaction interfaces

    • Map the structural domains involved in protein complex formation

  • Surface Plasmon Resonance (SPR):

    • Determine binding kinetics and affinity constants for purified interaction partners

    • Characterize the strength and specificity of protein-protein interactions

    • Test the impact of mutations or environmental conditions on binding properties

  • Protein Complex Analysis by Blue Native PAGE:

    • Isolate native protein complexes containing Sb05g019440 from plant tissues

    • Determine the molecular weight and composition of multiprotein complexes

    • Identify the stoichiometry of protein associations in Casparian strip formation

How can researchers address apparent contradictions in data regarding Sb05g019440 function?

When faced with contradictory findings regarding Sb05g019440 function, researchers should employ a systematic approach to reconcile discrepancies:

  • Contextual Analysis:

    • Examine the experimental context of contradictory claims, including study design, methodology, and model systems

    • Determine if contradictions stem from different developmental stages, tissues, or environmental conditions

    • Consider if contradictions reflect genuine biological complexity rather than experimental error

  • Standardized Terminology:

    • Use normalized gene and protein nomenclature to ensure comparison of identical entities

    • Address acronym inconsistencies and alternative naming conventions (e.g., SbCASPL1U2 vs. Sb05g019440)

    • Create relationship maps to clarify the connections between seemingly contradictory findings

  • Contradiction Classification Framework:

    • Categorize contradictions using a structured framework similar to the one proposed by Alamri for SemMedDB analysis:

      • Type 1: Positive vs. negative relationship between same entities

      • Type 2: Excitatory vs. inhibitory relationship between same entities

      • Type 3: Inhibitory vs. negated inhibitory relationship

      • Type 4: Other relation types vs. their negation

  • Statistical Meta-Analysis:

    • Pool data from multiple studies to increase statistical power

    • Apply weighted analysis based on study quality and methodological rigor

    • Conduct sensitivity analyses to identify experimental variables that explain apparent contradictions

What bioinformatic tools and databases are most valuable for analyzing Sb05g019440 in comparative studies?

For comprehensive comparative analysis of Sb05g019440, researchers should utilize the following bioinformatic resources:

  • Sequence and Structure Analysis Tools:

    • UniProt (ID: C5Y376) for protein sequence and annotation information

    • BLAST and HHsearch for identifying homologs in other species

    • Protein threading methods for detecting distant structural relationships

    • CASP (Critical Assessment of Structure Prediction) resources for structural modeling approaches

  • Functional Annotation Databases:

    • Gene Ontology (GO) for functional classification

    • Kyoto Encyclopedia of Genes and Genomes (KEGG) for pathway mapping

    • Plant-specific databases like Gramene for cereal-specific annotations

    • SorghumBase for Sorghum bicolor-specific genomic resources

  • Expression Data Repositories:

    • Gene Expression Omnibus (GEO) for transcriptomic datasets

    • Expression Atlas for tissue and condition-specific expression patterns

    • Sorghum RNA-seq databases for developmental and stress-response profiles

  • Orthology Analysis Tools:

    • OrthoFinder or OrthoMCL for identifying orthologous genes across species

    • Comparative genomic platforms to trace evolutionary relationships

    • Plant-specific orthology databases to identify functional conservation

  • Network Analysis Resources:

    • STRING database for protein-protein interaction predictions

    • Cytoscape for visualization and analysis of interaction networks

    • Plant-specific interaction databases to place Sb05g019440 in broader signaling contexts

How can Sb05g019440 be utilized in engineering salt tolerance in crop plants?

Sb05g019440's role in apoplastic barrier formation and potential contribution to salt exclusion mechanisms makes it a promising candidate for crop improvement strategies:

What experimental approaches can reveal the three-dimensional structure of Sb05g019440?

Determining the three-dimensional structure of Sb05g019440 requires sophisticated experimental and computational approaches:

  • X-ray Crystallography:

    • Express and purify large quantities of recombinant Sb05g019440 protein

    • Optimize crystallization conditions through systematic screening

    • Collect high-resolution diffraction data at synchrotron radiation facilities

    • Solve the structure using molecular replacement or experimental phasing techniques

  • Cryo-Electron Microscopy (Cryo-EM):

    • Prepare purified protein or protein complexes for cryo-EM analysis

    • Collect high-resolution images of flash-frozen samples

    • Perform single-particle reconstruction to determine the 3D structure

    • This approach is particularly valuable for membrane-associated proteins like Sb05g019440

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Produce isotopically labeled protein (15N, 13C, 2H) in E. coli

    • Collect multidimensional NMR spectra to assign resonances

    • Generate distance and angle constraints for structure calculation

    • This method is suitable for determining both structure and dynamics

  • Integrative Structural Biology:

    • Combine low-resolution experimental data (SAXS, SANS) with computational modeling

    • Use homology modeling based on related CASP-like proteins with known structures

    • Validate models using biochemical and biophysical experiments

    • Apply CASP-inspired methods for structure prediction and refinement

What are common issues in recombinant Sb05g019440 expression and purification?

Researchers frequently encounter several challenges when working with recombinant Sb05g019440:

  • Expression Optimization:

    • Challenge: Low protein yield in E. coli expression systems

    • Solution: Optimize codon usage for E. coli, lower expression temperature (16-20°C), use specialized strains like BL21(DE3)pLysS, or try alternative expression hosts

  • Protein Solubility:

    • Challenge: Formation of inclusion bodies due to improper folding

    • Solution: Express with solubility-enhancing tags (SUMO, GST), optimize induction conditions, or develop refolding protocols from inclusion bodies

  • Purification Efficiency:

    • Challenge: Contaminants co-purifying with His-tagged protein

    • Solution: Implement two-step purification (IMAC followed by size exclusion or ion exchange), optimize imidazole gradient, increase wash stringency

  • Protein Stability:

    • Challenge: Protein degradation during storage or handling

    • Solution: Add protease inhibitors, optimize buffer conditions, store with glycerol (50% final concentration), avoid repeated freeze-thaw cycles

  • Activity Preservation:

    • Challenge: Loss of functional activity after purification

    • Solution: Verify proper folding by circular dichroism, ensure removal of denaturing agents, add stabilizing cofactors or ligands

How can researchers validate the specificity and activity of recombinant Sb05g019440 protein?

To ensure the recombinant Sb05g019440 protein maintains its native specificity and activity, researchers should employ multiple validation approaches:

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure composition

    • Size-exclusion chromatography to verify proper oligomerization state

    • Thermal shift assays to determine protein stability under different conditions

  • Functional Assays:

    • Binding assays with known interaction partners from the Casparian strip formation pathway

    • In vitro reconstitution of minimal complexes with other CASP-like proteins

    • Membrane integration assays to confirm proper insertion into lipid bilayers

  • Complementation Studies:

    • Rescue experiments in Sb05g019440 knockout or knockdown plants

    • Measurement of Casparian strip integrity and function after complementation

    • Quantification of salt tolerance restoration in mutant lines

  • Immunological Verification:

    • Western blot analysis using antibodies specific to Sb05g019440 or the His tag

    • Immunolocalization to confirm proper subcellular targeting in plant cells

    • Epitope mapping to verify the preservation of key antigenic determinants

Validation MethodStrengthsLimitationsKey Measurements
Structural AnalysisProvides detailed information on protein foldingMay not correlate directly with functionCD spectra, thermal stability (Tm)
Binding AssaysDirectly measures interaction capabilityRequires known binding partnersBinding affinity (Kd), kinetics (kon, koff)
ComplementationTests biological function in native contextTime-consuming, complex systemPhenotypic rescue, Casparian strip integrity
ImmunologicalHigh specificity, sensitive detectionRequires specific antibodiesProtein expression, localization, integrity
Activity AssaysDirect measure of functional capacitySpecific assays may not be establishedEnzyme activity, membrane integration

What are the emerging research areas involving Sb05g019440 and related CASP-like proteins?

Several cutting-edge research directions are emerging in the study of Sb05g019440 and related CASP-like proteins:

  • Environmental Stress Adaptation:

    • Investigation of how Sb05g019440 expression and function changes under multiple stress conditions

    • Comparative analysis across Sorghum varieties with different stress tolerance profiles

    • Exploration of CASP-like protein evolution in relation to environmental adaptation

  • Protein-Membrane Dynamics:

    • Advanced imaging techniques to visualize Sb05g019440 dynamics in living cells

    • Single-molecule tracking to determine protein movement and clustering during barrier formation

    • Lipid interaction studies to understand membrane domain organization

  • Regulatory Networks:

    • Identification of transcription factors controlling Sb05g019440 expression

    • Characterization of post-translational modifications affecting protein function

    • Mapping of signaling cascades connecting environmental stimuli to barrier regulation

  • Synthetic Biology Applications:

    • Design of artificial Casparian strips with enhanced properties

    • Creation of minimal synthetic systems for barrier formation

    • Development of biosensors based on CASP-like protein dynamics

  • Comparative Genomics:

    • Pan-genomic analysis of CASP-like proteins across crop species

    • Investigation of neo- and sub-functionalization within the CASP-like protein family

    • Identification of key evolutionary innovations in terrestrial plant adaptation

How can multi-omics approaches enhance our understanding of Sb05g019440 function?

Integrative multi-omics strategies offer powerful approaches to comprehensively understand Sb05g019440 function:

  • Genomics-Transcriptomics Integration:

    • Correlate genetic variations in Sb05g019440 with expression differences

    • Identify cis- and trans-regulatory elements controlling expression

    • Map expression quantitative trait loci (eQTLs) affecting Sb05g019440 regulation

  • Proteomics-Interactomics Coupling:

    • Quantify Sb05g019440 protein abundance across developmental stages and conditions

    • Identify post-translational modifications using mass spectrometry

    • Map the complete interactome of Sb05g019440 in different cellular contexts

  • Metabolomics Correlation:

    • Track changes in lignin and suberin precursors in relation to Sb05g019440 activity

    • Correlate metabolite profiles with barrier development stages

    • Identify metabolic signatures of functional vs. compromised barriers

  • Phenomics Integration:

    • Connect molecular-level data to whole-plant phenotypes

    • Develop high-throughput phenotyping for barrier integrity and function

    • Create predictive models linking Sb05g019440 variation to plant performance

  • Data Integration Frameworks:

    • Develop computational pipelines to integrate multi-dimensional datasets

    • Apply machine learning approaches to identify patterns and relationships

    • Create network models predicting the impact of Sb05g019440 perturbations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.