Recombinant Sorghum bicolor CASP-like protein Sb05g025790 (Sb05g025790)

What is the biochemical characterization of Sorghum bicolor CASP-like protein Sb05g025790?

Sorghum bicolor CASP-like protein Sb05g025790 is a membrane protein with Uniprot number C5Y7C6, classified within the CASP (Casparian strip membrane domain proteins) family that is found in plants . The full amino acid sequence of the protein is "MAEEVWKALSLLFRIAALGLSLAAAIVMATASQLVIGGGGGHESSSYSVSFGQYNALRYFVAAGAISAVCSAAALYLFAVRADFTVVVVSLPLVPVLDAAAQGFLFSAAGAAFATRDVVGGGTSAGRGSSVCDAAGAFCGRVTVAAAVCAFAAVSVATAALASRDAGGGSSEGRRFEW", with an expression region spanning positions 1-178 . Analysis of this sequence reveals several hydrophobic regions indicative of membrane-spanning domains, which is consistent with its putative role in cell wall organization and membrane integrity.

The protein contains distinct structural motifs that suggest its involvement in protein-protein interactions within the plant cell membrane complex. Its sequence analysis indicates multiple transmembrane domains which are critical for its proper localization and function within the cell membrane architecture. The hydrophobic nature of these regions presents specific challenges for experimental work, requiring specialized approaches for solubilization and structural characterization.

Based on sequence homology with other CASP-like proteins, Sb05g025790 likely contributes to the formation of the Casparian strip, a specialized cell wall modification in the endodermis that controls transport between the cortex and stele in plant roots. This functional prediction is supported by comparative analysis with related CASP proteins in other plant species, though specific experimental validation in Sorghum bicolor remains to be fully documented.

What are the optimal storage and handling conditions for recombinant Sb05g025790?

The recombinant Sb05g025790 protein requires specific storage conditions to maintain stability and biological activity. According to product information, the shelf life is highly dependent on storage state, buffer ingredients, and temperature . For the liquid form, a shelf life of approximately 6 months can be expected when stored at -20°C or -80°C . The lyophilized form demonstrates greater stability, with a shelf life of up to 12 months at the same temperature range .

For optimal handling, it is recommended that the protein be stored in a buffer containing 50% glycerol, which serves as a cryoprotectant . This high glycerol concentration prevents ice crystal formation that can damage protein structure during freeze-thaw cycles. The commercially available recombinant protein is typically prepared in a Tris-based buffer system optimized for protein stability .

Researchers should note that repeated freezing and thawing significantly compromises protein integrity and should be strictly avoided . When working with the protein, it is advisable to prepare small working aliquots that can be stored at 4°C for up to one week to minimize freeze-thaw cycles . For reconstitution of lyophilized protein, it is recommended to briefly centrifuge the vial before opening to collect all material at the bottom, followed by reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage of reconstituted protein, addition of glycerol to a final concentration of 5-50% is recommended before aliquoting and storing at -20°C or -80°C .

How does Sb05g025790 compare to other CASP-like proteins in Sorghum bicolor?

The Sorghum bicolor genome encodes multiple CASP-like proteins that share sequence similarities but exhibit distinct expression patterns and potentially diverse functions. Comparing Sb05g025790 (Uniprot: C5Y7C6) with another characterized CASP-like protein from Sorghum bicolor, Sb07g025950 (Uniprot: C5YHP6), reveals important differences in their primary structures and potential functional specializations .

Analysis of the amino acid sequences shows that while both proteins belong to the CASP family, they have different lengths: Sb05g025790 spans 178 amino acids, while Sb07g025950 consists of 181 residues . The sequence alignment indicates approximately 45% identity between these two proteins, with conservation primarily in the transmembrane domains and certain motifs associated with membrane localization.

Sb05g025790 presents a sequence (MAEEVWKALSLLFRIAALGLSLAAAIVMATASQLVIGGGGGHESSSYSVSFGQYNALRYFVAAGAISAVCSAAALYLFAVRADFTVVVVSLPLVPVLDAAAQGFLFSAAGAAFATRDVVGGGTSAGRGSSVCDAAGAFCGRVTVAAAVCAFAAVSVATAALASRDAGGGSSEGRRFEW) that contains a higher proportion of glycine residues and characteristic "GGGG" repeat motifs that are less prominent in Sb07g025950 . In contrast, Sb07g025950 (MTMELESQEVVVETTTAAAAARAASAAHVRTTVALRLLAFAASLAAAVVVATNRQERWGITVTFKMFAVWEAFVAINFACAAYALLTAVFVKKLVSKHWLHHMDQFTVNLQAASTAGAGAVGSVAMWGNEPSGWYAVCRLYRLYCDRGAVSLALAFVAFVAFGVASSLSRYPRAPPPPAPPR) has more charged residues in specific domains and a distinctive C-terminal region rich in proline residues .

These sequence differences suggest potential functional divergence, with Sb05g025790 possibly more involved in structural roles within the cell wall matrix due to its glycine-rich regions, while Sb07g025950 may participate in different protein-protein interactions or regulatory functions based on its charged residue distribution and proline-rich C-terminus. These distinctions highlight the importance of studying individual CASP-like proteins rather than generalizing across the family.

What experimental approaches are recommended for studying the membrane localization of Sb05g025790?

Investigating the membrane localization of CASP-like protein Sb05g025790 requires specialized approaches due to its hydrophobic nature and predicted transmembrane domains. A comprehensive experimental strategy should incorporate multiple complementary techniques to validate localization patterns.

Confocal microscopy using fluorescent protein fusions represents a primary approach. Researchers should design constructs where Sb05g025790 is fused to fluorescent reporters such as GFP or mCherry, preferably with flexible linkers to minimize interference with protein folding and localization. These constructs should be expressed in either Sorghum bicolor tissues via Agrobacterium-mediated transformation (similar to the approach used for Sb4CL in search result ) or in heterologous plant systems like Arabidopsis or Nicotiana benthamiana. When designing these experiments, it is critical to consider both N- and C-terminal fusion proteins, as the position of the tag may affect trafficking and membrane insertion.

For biochemical validation of membrane association, subcellular fractionation followed by Western blot analysis provides quantitative assessment. This approach requires preparation of microsomal fractions from plant tissues expressing either native or tagged Sb05g025790, followed by differential centrifugation to separate various membrane compartments. The distribution of Sb05g025790 can then be analyzed using antibodies against the native protein or against epitope tags if using recombinant versions. This technique should incorporate appropriate membrane markers for different cellular compartments (plasma membrane, endoplasmic reticulum, Golgi apparatus) to precisely define the localization pattern.

For higher resolution analysis, immunogold electron microscopy offers nanometer-scale localization precision. This technique requires development of specific antibodies against Sb05g025790 or utilization of anti-tag antibodies for recombinant versions. Sample preparation requires careful fixation and embedding protocols optimized for membrane proteins, followed by ultrathin sectioning and immunolabeling with gold-conjugated secondary antibodies.

How can recombinant Sb05g025790 be utilized in studies of plant cell wall formation and lignin biosynthesis?

Recombinant Sb05g025790 offers significant potential for investigating cell wall formation and lignin biosynthesis in Sorghum bicolor, processes critical for biomass quality and biofuel production. Recent research on lignin modification in Sorghum bicolor, through manipulation of the 4-coumarate:CoA ligase (4CL) pathway , provides a conceptual framework for how CASP-like proteins might integrate into these processes.

Protein-protein interaction studies represent a primary approach for elucidating Sb05g025790's role in cell wall formation. The purified recombinant protein (as described in search results ) can be utilized in pull-down assays or surface plasmon resonance experiments to identify binding partners from cell wall biosynthetic machinery. These experiments require careful consideration of the protein's hydrophobic nature, potentially necessitating the addition of appropriate detergents or amphipols to maintain proper folding while allowing specific interactions.

Co-immunoprecipitation assays from plant microsomal fractions using antibodies against Sb05g025790 can validate interactions under more native conditions. Tagged versions of the recombinant protein can facilitate these studies when specific antibodies are unavailable. The protein complexes identified should be analyzed using mass spectrometry to identify potential partners involved in lignin biosynthesis or cell wall assembly.

Functional complementation studies offer another valuable approach. The recombinant protein can be used to rescue mutant phenotypes in either Sorghum bicolor or model systems like Arabidopsis with mutations in orthologous genes. This requires developing appropriate expression systems and evaluating phenotypic rescue through microscopic examination of Casparian strip formation and biochemical analysis of cell wall composition. The methodology would parallel approaches used in the study of Sb4CL gene silencing , which demonstrated significant alterations in lignin content (up to 25% reduction) and compensatory increases in cellulose (36.56%) and soluble sugars (59.72%).

Additionally, in vitro reconstitution systems incorporating purified recombinant Sb05g025790 with cell wall precursors can provide mechanistic insights into its function. These experimental systems should be designed to assess whether the protein influences polymerization rates of lignin precursors or modifies the interaction between cell wall components.

What methodologies are recommended for investigating protein-protein interactions of Sb05g025790?

Investigating protein-protein interactions (PPIs) of membrane-associated proteins like Sb05g025790 presents unique challenges that require specialized methodological approaches. A comprehensive investigation should employ multiple complementary techniques to identify and validate interaction partners.

Membrane yeast two-hybrid (MYTH) systems offer advantages over conventional yeast two-hybrid approaches for membrane proteins. In this system, Sb05g025790 should be expressed as a bait fusion protein with a split ubiquitin moiety, while a prey library derived from Sorghum bicolor cDNA (preferably from tissues where Sb05g025790 is expressed) is fused to the complementary ubiquitin fragment. Interaction reconstitutes ubiquitin, leading to reporter gene activation. This system accounts for the membrane localization of Sb05g025790, allowing screening in a membrane context rather than forcing nuclear localization as in conventional Y2H.

Co-immunoprecipitation coupled with mass spectrometry provides an unbiased approach for identifying native interaction complexes. For this methodology, either specific antibodies against Sb05g025790 or epitope-tagged versions expressed in Sorghum bicolor should be used. Microsomal fractions from appropriate tissues should be solubilized using mild detergents that preserve protein-protein interactions (such as digitonin or n-dodecyl-β-D-maltoside). Immunoprecipitated complexes can then be analyzed by mass spectrometry to identify interacting partners.

For validation and quantitative analysis of specific interactions, bimolecular fluorescence complementation (BiFC) and Förster resonance energy transfer (FRET) provide powerful in vivo approaches. These techniques require construction of fusion proteins where Sb05g025790 and potential interaction partners are linked to complementary fragments of fluorescent proteins (for BiFC) or compatible FRET pairs. These constructs should be co-expressed in plant systems through Agrobacterium-mediated transformation, similar to the approach used for transforming Sorghum bicolor in the Sb4CL study .

Protein microarrays represent another high-throughput approach for identifying potential interactions. The purified recombinant Sb05g025790 can be used to probe arrays containing other plant proteins, or conversely, the recombinant protein can be immobilized and used to capture interacting partners from plant extracts. This approach requires careful consideration of buffer conditions and detergents to maintain protein solubility while preserving native interactions.

What are the methodological considerations for expressing full-length versus partial recombinant Sb05g025790?

The expression of membrane proteins like Sb05g025790 presents significant challenges due to their hydrophobic nature and the presence of multiple transmembrane domains. The decision between expressing full-length versus partial constructs requires careful consideration of experimental objectives and expression system limitations.

For full-length protein expression, eukaryotic systems offer advantages for proper folding and post-translational modifications. Yeast expression systems, as used for commercially available recombinant Sb05g025790 , provide a balance between protein yield and proper folding. When using yeast systems, optimization of codon usage for Sorghum bicolor genes is essential to enhance expression efficiency. Additionally, inclusion of appropriate signal sequences and strategic placement of purification tags (either N- or C-terminal, depending on topology predictions) can significantly improve yield and purity.

Expression temperature optimization is critical, with lower temperatures (15-20°C) often improving folding of membrane proteins. For purification, a two-step approach incorporating immobilized metal affinity chromatography followed by size exclusion chromatography in the presence of appropriate detergents (such as n-dodecyl-β-D-maltoside or lauryl maltose neopentyl glycol) typically yields the highest purity while maintaining protein stability and native conformation.

For partial constructs focusing on soluble domains, bacterial expression systems like E. coli offer higher yields and simpler purification protocols. These constructs should be designed based on careful bioinformatic analysis to preserve intact domains while excluding transmembrane regions. The commercially available partial recombinant protein demonstrates the feasibility of this approach , though researchers should consider that partial constructs may not fully recapitulate the native protein's interactions and functions.

For structural studies, insect cell expression systems often provide advantages for complex membrane proteins. Baculovirus-mediated expression in Sf9 or High Five cells permits proper folding while yielding sufficient quantities for crystallization or cryo-electron microscopy studies. When preparing samples for structural analysis, detergent screening is essential to identify conditions that maintain protein stability while allowing crystal formation or homogeneous particle distribution for cryo-EM.

The purity requirement for different experimental applications should also guide the expression strategy. While functional studies may tolerate purities of >85% as indicated in the commercial product , structural studies typically require >95% purity and monodisperse samples.