Recombinant Sorghum bicolor CASP-like protein Sb06g033470 (Sb06g033470)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Sb06g033470; Casparian strip membrane protein 1; SbCASP1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Sorghum bicolor (Sorghum) (Sorghum vulgare)
Target Names
Sb06g033470
Target Protein Sequence
MSTSEAGAAATVIPIDDVARDHGKAPAVATAPPPPAAAAAVPAAATTTAPRKTGVPFFRR ADRGSRCVALLDFVLRVAAFGPALAAAIATGTSDETLSVFTQFFQFHARFDDFPALLFFM VANAIAAGYLVLSLPFSAVIVLRPQAIGLRHLLLVCDMIIAALLTAAAAAAAAIVDLAHS GNLRANWVPICMQFHGFCQRTSGAVVGSFLAVLVLLFLVILAAFAIRKR
Uniprot No.

Target Background

Function
This protein regulates membrane-cell wall junctions and localized cell wall deposition. It is essential for the establishment of the Casparian strip membrane domain (CSD) and subsequent Casparian strip formation. The Casparian strip, a cell wall modification in the root endodermis, creates an apoplastic barrier between the intraorganismal and extraorganismal apoplasm, preventing lateral diffusion.
Database Links

KEGG: sbi:8076491

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Sorghum bicolor CASP-like protein Sb06g033470 and how is it characterized?

Sorghum bicolor CASP-like protein Sb06g033470 is a member of the CASP protein family (UPF0497), which includes proteins involved in Casparian strip formation in plants. The recombinant protein consists of 229 amino acids with the sequence beginning with "MSTSEAGAAATVIPIDDVARDH" and ending with "FLVILAAFAIRKR" . Bioinformatic analysis predicts that CASP-like proteins typically contain four transmembrane domains, making them integral membrane proteins .

Similar to other CASP-like proteins, such as ClCASPL from watermelon and AtCASPL4C1 from Arabidopsis, the Sorghum bicolor CASP-like protein likely localizes to the plasma membrane . While specific localization studies for the Sorghum protein have not been detailed in the provided information, fluorescence microscopy analysis of related proteins has confirmed plasma membrane localization .

How do CASP-like proteins function in plant development?

CASP-like proteins are primarily known for their role in Casparian strip formation in the endodermis of plant roots. The Casparian strip serves as a barrier that regulates the movement of water and solutes through the apoplastic pathway in roots. In Arabidopsis, five CASP proteins (CASP1/2/3/4/5) have been identified to mediate Casparian strip formation .

What experimental approaches are used to study CASP-like protein expression?

Several complementary approaches are employed to study CASP-like protein expression:

  • Quantitative PCR (qPCR): Used to measure transcript abundance under different conditions, such as cold stress .

  • Promoter-GUS Fusion Analysis: The promoter region of the gene is fused to a β-glucuronidase (GUS) reporter gene to visualize spatial and temporal expression patterns. This approach has been used to show that AtCASPL4C1 is widely expressed in various organs and is cold-inducible .

  • In silico Transcript Abundance Analysis: Computational methods to analyze expression patterns across different tissues and conditions .

  • Fluorescent Protein Tagging: Fusion of the CASP-like protein with fluorescent proteins like GFP helps determine subcellular localization, as demonstrated with ClCASPL-GFP localizing to the plasma membrane .

These approaches provide complementary information about when, where, and how much of the CASP-like protein is expressed in response to different developmental and environmental cues.

What is known about the evolutionary relationships among CASP-like proteins?

CASP-like proteins form part of a larger family with members across different plant species. Phylogenetic analysis of the CASP family in Arabidopsis identified 39 genes defined as part of the CASP family (UPF0497), which can be classified into 6 subfamilies using the Neighbor-Joining method .

The Sorghum bicolor CASP-like protein Sb06g033470 is likely orthologous to CASP-like proteins in other species. For instance, ClCASPL from watermelon and AtCASPL4C1 (At3g55390) from Arabidopsis are orthologous, and both belong to the same subfamily in phylogenetic analyses . This evolutionary conservation suggests functional significance across different plant species.

The table below illustrates the comparative features of CASP-like proteins across different plant species:

FeatureSorghum bicolor Sb06g033470Arabidopsis AtCASPL4C1Watermelon ClCASPL
Protein Length229 amino acids Similar lengthSimilar length
Transmembrane DomainsPredicted 44 (aa 36-56, 78-98, 119-139, 160-180) 4 (aa 45-67, 87-109, 130-149, 169-191)
Cellular LocalizationPlasma membrane (predicted)Plasma membranePlasma membrane
Gene ExpressionNot specifiedWidely expressed, cold-inducible Cold-inducible
FunctionNot fully characterizedCold tolerance, growth regulation Cold tolerance

How can functional analysis be designed to characterize the role of recombinant Sorghum bicolor CASP-like protein?

Functional analysis of recombinant Sorghum bicolor CASP-like protein Sb06g033470 requires a multi-faceted experimental approach:

Genetic Manipulation Studies:

  • Generate knockout or knockdown lines using CRISPR-Cas9 or RNAi techniques

  • Create overexpression lines using constitutive or inducible promoters

  • Compare phenotypes of modified plants with wild-type controls under various conditions (normal growth, cold stress, drought stress)

Protein-Protein Interaction Analysis:

  • Yeast two-hybrid screening to identify interacting partners

  • Co-immunoprecipitation followed by mass spectrometry

  • Bimolecular fluorescence complementation (BiFC) to confirm interactions in planta

Functional Complementation:

  • Express Sorghum Sb06g033470 in Arabidopsis AtCASPL4C1 knockout lines to assess functional conservation

  • Evaluate if complementation restores wild-type phenotypes regarding growth dynamics and cold tolerance

Based on studies with orthologous proteins, phenotypic analysis should focus on growth parameters, flowering time, biomass accumulation, and stress tolerance, particularly cold stress response . Additionally, examining Casparian strip formation in roots using lignin staining would determine if the protein functions in barrier formation similar to CASP1-5 proteins .

What methodological considerations are important when working with recombinant CASP-like proteins?

Working with recombinant CASP-like proteins presents several technical challenges due to their membrane-associated nature:

Protein Expression and Purification:

  • Expression systems: Bacterial systems may be problematic due to the membrane-associated nature; consider eukaryotic expression systems like yeast, insect cells, or plant-based expression

  • Solubilization strategies: Use appropriate detergents (e.g., n-dodecyl-β-D-maltoside or CHAPS) to extract membrane proteins

  • Purification optimization: Employ affinity tags (His, GST, or FLAG) for purification while maintaining protein folding and function

Storage and Stability:

  • Store in appropriate buffer containing 50% glycerol at -20°C for general storage or -80°C for extended storage

  • Avoid repeated freeze-thaw cycles as this can compromise protein integrity

  • Prepare working aliquots that can be stored at 4°C for up to one week

Functional Assays:

  • Develop in vitro assays reflecting physiological functions

  • For membrane association studies, consider liposome reconstitution experiments

  • For protein-protein interaction studies, consider detergent compatibility with interaction assays

Structural Analysis:

  • Employ circular dichroism to assess secondary structure elements

  • For transmembrane proteins, consider techniques like cryo-electron microscopy rather than X-ray crystallography alone

Importantly, the tag type used for purification should be carefully chosen and may need to be determined during the production process to optimize protein yield and activity .

How can transcriptomic approaches enhance our understanding of CASP-like protein function in Sorghum?

Transcriptomic approaches offer powerful tools to elucidate the function of CASP-like proteins in Sorghum:

RNA-Seq Analysis:

  • Compare gene expression profiles between wild-type and Sb06g033470 knockout/overexpression lines

  • Identify differentially expressed genes (DEGs) that may represent downstream targets or partners

  • Perform Gene Ontology (GO) enrichment analysis of DEGs to identify affected biological processes

Co-expression Network Analysis:

  • Construct gene co-expression networks to identify genes with similar expression patterns as Sb06g033470

  • Identify potential regulatory modules and functional associations

Condition-Specific Expression Profiling:

  • Analyze expression under various abiotic stresses (cold, drought, salinity)

  • Examine expression across developmental stages and tissues

  • Identify environmental and developmental cues that regulate Sb06g033470 expression

Integration with Other -Omics Data:

  • Combine transcriptomic data with proteomic, metabolomic, and phenomic data

  • Use systems biology approaches to build comprehensive models of CASP-like protein function

Based on findings from related CASP-like proteins, particular attention should be paid to expression patterns during cold stress and in different tissue types . The analysis should examine potential correlations with other CASP family members, especially CASP1-5, which have established roles in Casparian strip formation .

What strategies can be employed to analyze the structure-function relationship of Sorghum CASP-like proteins?

Understanding the structure-function relationship of Sorghum CASP-like proteins requires an integrated approach:

Computational Structure Prediction:

  • Use homology modeling based on structurally characterized membrane proteins

  • Employ ab initio modeling for regions without homologous templates

  • Predict transmembrane domains and their orientations using specialized algorithms

  • Identify conserved motifs through multiple sequence alignment with other CASP-like proteins

Site-Directed Mutagenesis:

  • Generate variants with mutations in predicted functional domains

  • Target conserved residues identified through comparative analysis

  • Create chimeric proteins by swapping domains with other CASP family members

  • Test mutant protein function in complementation studies

Biophysical Characterization:

  • Circular dichroism spectroscopy to assess secondary structure

  • Fluorescence spectroscopy to monitor conformational changes

  • Surface plasmon resonance to quantify binding interactions

  • Small-angle X-ray scattering for low-resolution structural information

Advanced Imaging:

  • Cryo-electron microscopy for membrane protein structures

  • Single-particle analysis to determine 3D structure

  • Super-resolution microscopy to visualize protein localization in cellular context

The four transmembrane domains predicted in CASP-like proteins (similar to those in AtCASPL4C1 at amino acids 36-56, 78-98, 119-139, and 160-180) would be primary targets for structure-function analysis . Additionally, identifying residues that differ between cold-sensitive and cold-tolerant CASP-like proteins could provide insights into their role in stress tolerance .

How can systems biology approaches be used to integrate CASP-like protein function into broader cellular networks?

Systems biology offers powerful frameworks to contextualize CASP-like protein function within larger cellular networks:

Multi-omics Data Integration:

  • Combine transcriptomic, proteomic, metabolomic, and phenomic datasets

  • Use computational tools to identify correlations across different data types

  • Apply dimension reduction techniques to visualize complex relationships

Network Biology Approaches:

  • Construct protein-protein interaction networks including Sb06g033470

  • Analyze metabolic networks affected by CASP-like protein function

  • Build gene regulatory networks to identify transcription factors controlling Sb06g033470 expression

Pathway Enrichment Analysis:

  • Identify biological pathways enriched among genes/proteins affected by Sb06g033470 manipulation

  • Focus on pathways related to cold response, Casparian strip formation, and growth regulation

  • Compare pathway enrichment across different stress conditions

Mathematical Modeling:

  • Develop ordinary differential equation models of processes involving CASP-like proteins

  • Create Boolean network models to simulate regulatory relationships

  • Use flux balance analysis to predict metabolic consequences of CASP-like protein perturbation

Comparative Systems Analysis:

  • Compare networks across different plant species with CASP-like proteins

  • Identify conserved modules indicating core functions

  • Highlight species-specific differences suggesting adaptive specialization

This integrated approach would build upon observations from Arabidopsis studies showing that AtCASPL4C1 knockout affects the expression of CASP1-5 genes, suggesting regulatory interactions within the CASP family that influence Casparian strip formation . Additionally, the observed effects on growth dynamics and stress tolerance indicate connections to broader signaling networks that could be mapped through systems approaches .

What are the optimal conditions for handling and storage of recombinant Sorghum bicolor CASP-like protein?

Proper handling and storage are critical for maintaining the integrity and activity of recombinant Sorghum bicolor CASP-like protein Sb06g033470:

Storage Recommendations:

  • Store at -20°C for routine storage

  • For extended storage, keep at -20°C or preferably -80°C

  • Store in a Tris-based buffer containing 50% glycerol that has been optimized for protein stability

  • Prepare working aliquots to avoid repeated freeze-thaw cycles

Working Conditions:

  • Working aliquots can be stored at 4°C for up to one week

  • Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity

  • When designing experiments, consider the membrane-associated nature of the protein

Quality Control Measures:

  • Regularly assess protein integrity using SDS-PAGE

  • Verify activity using functional assays specific to CASP-like proteins

  • Monitor for degradation or aggregation that may affect experimental results

These recommendations align with standard practices for membrane protein handling while specifically addressing the documented storage requirements for this recombinant protein .

What experimental controls should be included when studying Sorghum CASP-like protein function?

Robust experimental design for studying Sorghum CASP-like protein function requires comprehensive controls:

Genetic Controls:

  • Wild-type plants as negative controls

  • Known CASP family mutants (e.g., from Arabidopsis) as comparative controls

  • Multiple independent transgenic lines to control for positional effects

  • Empty vector controls for transformation experiments

Biochemical Controls:

  • Heat-inactivated protein for enzyme assays

  • Irrelevant proteins of similar size/structure for specificity tests

  • Non-specific antibodies for immunolocalization experiments

  • Isotype controls for immunoprecipitation studies

Environmental Controls:

  • Growth chamber controls to ensure consistent conditions

  • Time-matched samples for developmental studies

  • Multiple biological and technical replicates

  • Randomized experimental design to minimize position effects

Analytical Controls:

  • Standard curves for quantitative measurements

  • Internal reference genes for qPCR studies

  • Loading controls for western blots

  • Fluorescence controls for microscopy studies

When studying cold stress responses, particularly careful control of temperature conditions is essential, given the established role of CASP-like proteins in cold tolerance . Additionally, when examining Casparian strip formation, appropriate staining controls and quantification methods should be employed, similar to those used in Arabidopsis studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.