Recombinant Sorghum bicolor CASP-like protein Sb08g021090 (Sb08g021090)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare your order according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Please note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
Sb08g021090; CASP-like protein 1B1; SbCASPL1B1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-211
Protein Length
full length protein
Species
Sorghum bicolor (Sorghum) (Sorghum vulgare)
Target Names
Sb08g021090
Target Protein Sequence
MDLERGSKTPPSSAPAAAAATTTTSTCCSNKRPQLRDRLVALQPVVLRAAATLATAVAAA VMALNAQSYTAVVAIVGTRPLTQTFTTKFRDTPAFVYFVIANAIAAVYNLVMLLFRCLIL RRRMAGLVVHMLDMVIMALLATGAATAAAMAELGKNGNVHARWNPICDRFGSFCSRGGVA LASSFTGVALMLALNLLSAASNAQCSPGQYE
Uniprot No.

Target Background

Database Links

KEGG: sbi:8070143

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the predicted structure and membrane topology of Sorghum bicolor CASP-like protein Sb08g021090?

Sorghum bicolor CASP-like protein Sb08g021090 likely exhibits structural characteristics similar to other CASP-family proteins. Based on homology with characterized CASP-like proteins such as Sb10g026120, it is predicted to contain four transmembrane helices, typical of the CASP protein family. The protein is expected to localize to the plasma membrane, as confirmed for related CASP proteins through GFP fusion assays in homologous systems. This membrane topology is essential for its putative function in forming protein scaffolds at the plasma membrane, particularly in specific root cell layers .

How does Sb08g021090 compare structurally to other characterized CASP-like proteins?

Sb08g021090 likely shares structural similarities with other characterized CASP-like proteins from various plant species. For comparative analysis, researchers should consider the following structural relationships:

FeatureSb08g021090 (Predicted)Sb10g026120 (Sorghum)AtCASPL4C1 (Arabidopsis)OsCASP1 (Rice)
Transmembrane domainsLikely fourFourFourFour
Subcellular localizationPlasma membranePlasma membranePlasma membranePlasma membrane
Protein familyCASP-likeCASP-likeCASP-likeCASP-like
Functional domainCasparian strip membrane domainCasparian strip membrane domainCasparian strip membrane domainCasparian strip membrane domain

Structural analysis suggests conservation across species, though specific functional adaptations may exist based on the plant's environment and evolutionary pressures .

What expression patterns would be expected for Sb08g021090 in Sorghum bicolor tissues?

Based on expression patterns observed in orthologous proteins, Sb08g021090 would likely show tissue-specific expression concentrated in root tissues, particularly in the endodermis and possibly in the stele and sclerenchyma. Drawing from research on rice OsCASP1, expression might be particularly high in small lateral root tips . Furthermore:

  • Expression levels may increase in response to abiotic stressors, particularly salt stress, as observed with rice OsCASP1

  • The protein may show developmental regulation, with expression patterns shifting during root maturation

  • Tissue-specific localization studies using promoter-GUS fusions (similar to those performed with OsCASP1) would be necessary to confirm these predicted patterns

Expression analysis through RT-qPCR across different tissues and developmental stages would provide definitive data on Sb08g021090's expression profile in Sorghum bicolor.

What methodologies are optimal for functionally characterizing Sb08g021090 in Sorghum bicolor?

Comprehensive functional characterization of Sb08g021090 requires a multi-faceted experimental approach:

Gene Knockout/Mutation Analysis:

  • CRISPR/Cas9-mediated gene editing to generate knockout mutants

  • Map-based cloning to identify natural mutations, similar to approaches used for rice OsCASP1

  • Analysis of phenotypic consequences in root development, nutrient uptake, and stress responses

Protein Localization Studies:

  • Construction of fluorescent protein fusions (e.g., Sb08g021090-GFP) under native promoter control

  • Confocal microscopy to determine precise subcellular localization

  • Co-localization studies with known endodermal markers

Physiological Assays:

  • Analysis of Casparian strip formation using berberine-aniline blue staining methods

  • Examination of suberin deposition patterns using fluorol yellow staining

  • Assessment of ion accumulation and nutrient homeostasis in wild-type versus mutant plants

Expression Analysis:

  • Construction of promoter-reporter fusions (e.g., Sb08g021090pro:GUS) to visualize expression patterns

  • RT-qPCR analysis of expression under various stress conditions and developmental stages

  • RNA-seq to identify co-regulated genes and potential regulatory networks

These approaches, similar to those employed for rice OsCASP1 and other CASP proteins, would provide comprehensive insights into Sb08g021090's function in Sorghum bicolor .

How might Sb08g021090 contribute to abiotic stress tolerance in Sorghum bicolor?

Sb08g021090 likely plays a crucial role in abiotic stress tolerance through its involvement in Casparian strip formation and regulation of nutrient/water transport. Based on findings from related CASP proteins:

Salt Stress Adaptation:

  • May regulate ion homeostasis by maintaining endodermal barrier integrity

  • Could be upregulated under salt stress conditions, similar to OsCASP1 in rice

  • May influence Na+/K+ balance by controlling apoplastic bypass flow

Drought Response:

  • Could contribute to water conservation by regulating hydraulic conductivity in roots

  • May influence ABA signaling pathways in response to water deficit

  • Potential role in modulating root architecture adaptations to drought

Cold Tolerance:

  • May function similarly to AtCASPL4C1 and ClCASPL orthologs as a negative regulator of cold stress responses

  • Could influence membrane fluidity and stability under low temperature conditions

Functional validation through stress tolerance assays comparing wild-type and knockout/knockdown plants would be essential to confirm these hypothesized roles in stress adaptation .

What protein-protein interactions might Sb08g021090 participate in during Casparian strip formation?

Sb08g021090 likely engages in complex protein-protein interactions to fulfill its role in Casparian strip formation. Based on known interactions of CASP family proteins:

Core CASP Complex Formation:

  • Potential oligomerization with other CASP family proteins (Sb08g021090 may interact with additional Sorghum CASP/CASP-like proteins)

  • Formation of a transmembrane scaffold in the plasma membrane of endodermal cells

  • These interactions create specialized membrane domains for lignin deposition

Lignin Biosynthetic Machinery:

  • Probable recruitment of peroxidases (particularly those homologous to PER64)

  • Interaction with NADPH oxidases for ROS production necessary for lignin polymerization

  • Potential association with monolignol transporters

Regulatory Interactions:

  • Possible association with kinases/phosphatases for post-translational regulation

  • Interaction with endodermal differentiation factors

  • Potential feedback regulation through sensing of completed Casparian strip formation

Yeast two-hybrid screens, co-immunoprecipitation, and FRET-based approaches would be valuable for identifying and characterizing these interactions in Sorghum bicolor .

What expression systems are optimal for producing recombinant Sb08g021090 protein?

Selection of an appropriate expression system for recombinant Sb08g021090 production requires careful consideration of protein characteristics and experimental objectives:

Expression SystemAdvantagesDisadvantagesRecommended Applications
E. coliCost-effective, high yield, rapid productionLimited post-translational modifications, potential inclusion body formationAntibody production, preliminary structural studies
Mammalian cellsPost-translational modifications feasible, native-like protein foldingHigher cost, lower yield, technical complexityFunctional studies requiring native conformation
BaculovirusSuitable for large-scale production, eukaryotic post-translational modificationsModerate cost, complex methodologyStructural biology, functional characterization
Plant-based systemsNative post-translational modifications, potential for functional proteinVariable yields, longer production timeIn planta functional studies, protein-protein interactions

For membrane proteins like Sb08g021090, consider:

  • Adding solubility tags (MBP, SUMO) to improve protein solubility

  • Optimizing codon usage for the chosen expression system

  • Incorporating purification tags that don't interfere with transmembrane domains

  • Using detergent screens to identify optimal solubilization conditions post-expression

What methods are most effective for visualizing Casparian strip formation in Sorghum bicolor roots?

Effective visualization of Casparian strips requires specialized staining and microscopy techniques:

Histochemical Staining Approaches:

  • Berberine-aniline blue staining: Apply clearing with lactic acid saturated with chloral hydrate followed by berberine-aniline blue staining to visualize lignified Casparian strips under fluorescence microscopy

  • Phloroglucinol staining: For lignin-specific detection in cross-sections

  • Basic Fuchsin staining: Alternative approach for lignin visualization, though may show different patterns than berberine-aniline blue

Suberin Visualization:

  • Fluorol Yellow 088 (FY088) staining: For specific visualization of suberin deposition patterns in root cross-sections

  • Autofluorescence: UV excitation to observe natural autofluorescence of suberin and lignin

Advanced Microscopy Approaches:

  • Confocal laser scanning microscopy: For detailed 3D visualization of stained Casparian strips

  • Transmission electron microscopy: For ultrastructural analysis of Casparian strip architecture

  • Raman microscopy: For label-free chemical imaging of lignin and suberin components

When implementing these methods, it's crucial to include appropriate developmental stages and root zones, as Casparian strip formation follows a developmental gradient along the root axis .

How can researchers effectively assess the impact of Sb08g021090 mutations on plant nutrient homeostasis?

Comprehensive assessment of how Sb08g021090 mutations affect nutrient homeostasis requires a multi-faceted analytical approach:

Ionomic Profiling:

  • ICP-MS (Inductively Coupled Plasma Mass Spectrometry) analysis of major and trace elements in different plant tissues

  • Comparison between wild-type and mutant plants under varying nutrient regimes

  • Spatial distribution analysis of elements across root, shoot, and reproductive tissues

Physiological Transport Assays:

  • Radiotracer studies using isotopes (e.g., 45Ca, 35S) to track specific nutrient movement

  • Measurement of apoplastic bypass flow using tracer dyes (e.g., propidium iodide)

  • Root pressure probe measurements to assess hydraulic conductivity changes

Molecular Responses:

  • RT-qPCR analysis of nutrient transporter genes in response to Sb08g021090 mutation

  • Transcriptomic profiling to identify compensatory mechanisms activated in mutants

  • Protein-level changes in key transporters through Western blotting or proteomics

Phenotypic Assessments:

  • Monitoring growth parameters under varying nutrient conditions

  • Assessment of stress symptoms (e.g., withered leaves, reduced tillering) as observed in rice OsCASP1 mutants

  • Root architecture analysis for adaptive responses to nutrient limitation

These approaches would help establish causal relationships between Sb08g021090 function, Casparian strip integrity, and plant nutrient acquisition efficiency .

How should researchers address contradictory data regarding Sb08g021090 function compared to orthologs in other species?

When faced with contradictory data between Sb08g021090 and its orthologs in other species, researchers should implement a systematic approach:

Methodological Reconciliation:

  • Standardize experimental conditions across species comparisons

  • Verify that identical techniques are used (e.g., staining protocols, microscopy settings)

  • Consider developmental timing differences between species

  • Document methodological details extensively to enable accurate replication

Evolutionary Context Analysis:

  • Conduct detailed phylogenetic analysis to establish true orthology relationships

  • Consider neofunctionalization or subfunctionalization of duplicated genes

  • Analyze promoter regions for divergent regulatory elements

  • Examine selective pressures that might drive functional divergence

Complementation Studies:

  • Perform cross-species complementation (e.g., express Sb08g021090 in Arabidopsis or rice casp mutants)

  • Analyze domain swapping between orthologous proteins to identify functional regions

  • Create chimeric proteins to test specific functional hypotheses

Multi-omics Integration:

  • Combine transcriptomic, proteomic, and metabolomic data to build comprehensive functional models

  • Look for system-level compensation mechanisms that might mask primary functions

  • Consider tissue-specific or condition-specific functional differences

When publishing, transparently acknowledge contradictions in the literature and provide possible explanations for observed differences, as seen with contradictory findings regarding rice OsCASP1 function in different studies .

What statistical approaches are most appropriate for analyzing Sb08g021090 expression data across different stress conditions?

Robust statistical analysis of Sb08g021090 expression data across stress conditions requires:

Experimental Design Considerations:

  • Include sufficient biological replicates (minimum n=3, preferably n≥5)

  • Incorporate appropriate time-course sampling to capture dynamic responses

  • Include multiple stress intensities to identify threshold responses

  • Design factorial experiments when examining multiple stress interactions

Normalization Strategies:

  • Select stable reference genes verified under the specific stress conditions being tested

  • Apply multiple reference gene normalization (e.g., geometric mean of 2-3 stable references)

  • Consider global normalization methods for RNA-seq data

  • Validate RNA-seq findings with RT-qPCR for genes of particular interest

Statistical Analysis Methods:

  • For simple comparisons: t-tests with appropriate corrections for multiple testing

  • For multiple conditions: ANOVA with post-hoc tests (Tukey's HSD for balanced designs)

  • For time-course data: repeated measures ANOVA or mixed-effects models

  • For complex experiments: multivariate approaches (PCA, hierarchical clustering)

Advanced Analytics:

  • Co-expression network analysis to identify genes with similar expression patterns

  • Machine learning approaches to identify complex expression patterns

  • Bayesian methods for integration of prior knowledge with experimental data

Visualize results using heat maps, box plots, and interaction plots to effectively communicate complex patterns, while maintaining transparency about statistical methods and significance thresholds .

How might CRISPR/Cas9 gene editing be optimized for studying Sb08g021090 function in Sorghum bicolor?

Optimizing CRISPR/Cas9 gene editing for Sb08g021090 functional studies requires:

Target Site Selection:

  • Design sgRNAs targeting conserved functional domains (transmembrane regions)

  • Avoid regions with high GC content that may reduce editing efficiency

  • Use multiple bioinformatic tools to predict off-target effects

  • Consider targeting different exons to create a series of allelic variants

Delivery Methods for Sorghum:

  • Optimize Agrobacterium-mediated transformation protocols specific to Sorghum bicolor

  • Consider biolistic delivery for recalcitrant varieties

  • Explore tissue-specific promoters for Cas9 expression to minimize developmental effects

  • Implement ribonucleoprotein (RNP) delivery methods for DNA-free editing

Screening Strategies:

  • Develop high-throughput genotyping protocols (e.g., T7E1 assay, HRMA)

  • Implement targeted deep sequencing for comprehensive mutation analysis

  • Design PCR primers to enable rapid identification of large deletions

  • Establish phenotypic screens relevant to expected CASP functions in roots

Validation Approaches:

  • Complementation with wild-type Sb08g021090 to confirm phenotype causality

  • Creation of tagged (e.g., GFP) rescue constructs for simultaneous function restoration and localization

  • Implementation of inducible systems to study temporal aspects of gene function

  • Development of tissue-specific knockouts to dissect cell-autonomous functions

This comprehensive approach would enable precise manipulation of Sb08g021090 to understand its functional role in Casparian strip formation and stress responses in Sorghum bicolor .

What comparative genomic approaches would yield insights into the evolution of CASP-like proteins in Poaceae?

Comprehensive comparative genomic analysis of CASP-like proteins in Poaceae should include:

Phylogenetic Analysis:

  • Construct maximum likelihood or Bayesian phylogenetic trees using amino acid sequences

  • Incorporate CASP-like proteins from diverse Poaceae species (rice, maize, wheat, barley, etc.)

  • Include outgroups from non-Poaceae monocots and dicots for evolutionary context

  • Calculate substitution rates to identify rapidly evolving regions

Synteny Analysis:

  • Examine conservation of genomic neighborhoods surrounding CASP genes

  • Identify tandem duplications and whole-genome duplication contributions

  • Map chromosomal rearrangements affecting CASP gene evolution

  • Correlate syntenic relationships with functional conservation/divergence

Selection Pressure Analysis:

  • Calculate dN/dS ratios across different domains to identify regions under purifying or positive selection

  • Implement site-specific selection models to identify key amino acids under selection

  • Compare selection patterns between transmembrane domains and cytoplasmic regions

  • Correlate selection patterns with known functional domains

Promoter Evolution:

  • Identify conserved cis-regulatory elements in CASP gene promoters

  • Map evolutionary changes in stress-responsive elements

  • Correlate promoter architecture with expression patterns

  • Identify potential regulatory innovations in specific lineages

This multi-faceted approach would provide insights into how CASP-like proteins evolved specialized functions in Poaceae, potentially correlating with adaptation to diverse environmental conditions .

How might understanding Sb08g021090 function contribute to improving Sorghum bicolor stress tolerance in changing climate conditions?

Research on Sb08g021090 has significant potential to contribute to climate resilience in Sorghum bicolor:

Drought Adaptation Applications:

  • Engineering optimized Sb08g021090 variants could enhance water use efficiency through improved root barrier function

  • Modifying expression patterns could optimize root hydraulic conductivity under water-limited conditions

  • Understanding its role in suberin deposition could lead to strategies for reduced water loss in drought

Salinity Tolerance Enhancement:

  • Precise modulation of Sb08g021090 expression could improve salt exclusion at the endodermis

  • Altered Casparian strip formation timing might enhance adaptation to saline conditions

  • Engineering protein variants with enhanced stability under ionic stress could improve salt tolerance

Nutrient Acquisition Optimization:

  • Fine-tuning Sb08g021090 function could enhance nutrient uptake efficiency in nutrient-poor soils

  • Modifying suberin deposition patterns might improve nutrient selectivity

  • Understanding CASP-mediated regulation of transporter localization could lead to improved nutrient acquisition

Implementation Strategies:

  • Development of stress-inducible Sb08g021090 expression systems

  • Creation of tissue-specific promoter modifications to optimize expression patterns

  • Screening of natural Sb08g021090 variants in diverse Sorghum germplasm for superior alleles

  • Precision breeding approaches incorporating beneficial Sb08g021090 alleles

These applications demonstrate how fundamental research on Sb08g021090 could translate into practical strategies for improving Sorghum climate resilience, particularly important as this crop is often grown in marginal environments facing increasing climate pressures .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.