Recombinant Sorghum bicolor Casparian strip membrane protein Sb10g008220 (Sb10g008220)

What is Sb10g008220 and what is its biological function?

Sb10g008220 is a Casparian strip membrane protein found in Sorghum bicolor, a major cereal crop also known as sorghum. The Casparian strip is a specialized cell wall modification in plant root endodermis cells that creates a barrier to regulate water and nutrient uptake. This protein is a transmembrane protein that contributes to the structural and functional integrity of the Casparian strip .

The full amino acid sequence of Sb10g008220 is: MKGSSEHGETSKAAPLGRGGVSKGVSVLDLILRFIAIIGTLASAIAMGTTNETLPFFTQFIRFKAQYSDLPTLTFFVVANSIVCAYLILSLPLSIVHIIRSRAKYSRLLLIFLDAAMLALVTAGASAAAAIVYLAHKGNVRANWLAICQQFDSFCERISGSLIGSFGAMVMLILLILLSAIALARR . This 186-amino acid sequence suggests a hydrophobic transmembrane protein consistent with its role in the Casparian strip membrane.

What is the structure of the Sb10g008220 protein?

The Sb10g008220 protein is a full-length transmembrane protein consisting of 186 amino acids. Based on its sequence analysis, it contains multiple hydrophobic domains characteristic of membrane proteins. The protein has several transmembrane helices that anchor it within the plant cell membrane .

The recombinant version available for research typically includes an N-terminal 10xHis-tag to facilitate purification by affinity chromatography. This tagged version maintains the structural characteristics of the native protein while providing an effective means for isolation and purification . The protein's hydrophobic nature requires special consideration during experimental design, particularly for solubilization and handling procedures.

How stable is recombinant Sb10g008220 under different storage conditions?

The stability of recombinant Sb10g008220 is significantly affected by storage conditions. For optimal stability, the protein should be stored at -20°C for regular use, or at -80°C for extended storage periods . The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which helps maintain protein stability during freeze-thaw cycles .

Repeated freezing and thawing is strongly discouraged as it leads to protein degradation and loss of activity. Working aliquots should be prepared and stored at 4°C for up to one week maximum to minimize degradation . The shelf life of the liquid form is approximately 6 months when stored at -20°C or -80°C, while the lyophilized form can maintain stability for up to 12 months under the same storage conditions .

What expression systems are most effective for producing recombinant Sb10g008220?

The most effective expression system for producing recombinant Sb10g008220 is an in vitro E. coli expression system . E. coli is routinely used for recombinant protein production due to its rapid growth, well-characterized genetics, and high expression levels .

For optimal expression of Sb10g008220, media composition plays a critical role. Based on comparative studies of recombinant protein expression, certain specialized media formulations have shown superior results compared to standard formulations like LB Broth or minimal media . The choice of media can significantly affect both the yield and solubility of the expressed protein.

How does media composition affect the expression of recombinant Sb10g008220?

Media composition has a profound impact on the expression levels and solubility of recombinant proteins, including Sb10g008220. Research has demonstrated that different media formulations can lead to significant variations in protein yield and quality . The table below summarizes the relative effectiveness of different media for recombinant protein expression:

Power Broth™ has shown excellent results for membrane proteins similar to Sb10g008220, making it a primary choice for expression . The media composition affects not only the amount of recombinant protein accumulated but also the fraction that remains soluble, which is particularly important for membrane proteins like Sb10g008220 .

What purification strategies yield the highest purity of recombinant Sb10g008220?

The recombinant Sb10g008220 protein is typically produced with an N-terminal 10xHis-tag, which facilitates efficient purification using immobilized metal affinity chromatography (IMAC) . For optimal purification results, a multi-step strategy is recommended:

• Initial capture using Ni-NTA or similar IMAC resin under native or denaturing conditions, depending on protein solubility

• Intermediate purification using ion exchange chromatography to remove remaining contaminants

• Final polishing step using size exclusion chromatography to achieve high purity

For membrane proteins like Sb10g008220, the addition of appropriate detergents during extraction and purification is crucial to maintain protein solubility and native conformation. Common detergents include n-dodecyl-β-D-maltoside (DDM) or 3-[(3-cholamidopropyl)dimethylammonio]-1-propanesulfonate (CHAPS) at concentrations above their critical micelle concentration (CMC) .

How can protein-protein interactions of Sb10g008220 be effectively studied?

Studying protein-protein interactions of Sb10g008220 requires specialized approaches due to its membrane-bound nature. Several complementary techniques can be employed:

• Yeast two-hybrid (Y2H) system with modifications for membrane proteins, such as split-ubiquitin Y2H, which is specifically designed for transmembrane proteins

• Co-immunoprecipitation (Co-IP) using the His-tag on recombinant Sb10g008220 as a handle for pulldown experiments

• Bimolecular fluorescence complementation (BiFC) for in vivo visualization of protein interactions

• Surface plasmon resonance (SPR) for quantitative measurement of binding kinetics

• Crosslinking mass spectrometry (XL-MS) to identify interaction partners and interfaces

When designing these experiments, it's essential to consider the native membrane environment of Sb10g008220. For in vitro studies, reconstitution into liposomes or nanodiscs can provide a more physiologically relevant context than detergent-solubilized proteins . For in vivo studies, heterologous expression in plant systems most closely related to Sorghum bicolor will yield the most relevant results.

What approaches can be used to investigate the functional role of Sb10g008220 in Casparian strip formation?

Investigating the functional role of Sb10g008220 in Casparian strip formation requires a multi-faceted approach combining molecular, cellular, and physiological techniques:

• Gene knockout or CRISPR-Cas9 gene editing in Sorghum bicolor to generate plants lacking functional Sb10g008220

• Complementation studies using the recombinant protein to rescue mutant phenotypes

• Fluorescence imaging of Casparian strip integrity using apoplastic tracers

• Electron microscopy to examine ultrastructural changes in the Casparian strip

• Physiological assays measuring water and nutrient uptake to assess functional consequences of Sb10g008220 modification

For cellular localization studies, fluorescently tagged versions of Sb10g008220 can be expressed in plant cells to visualize its distribution and dynamics. When designing fusion proteins, it's important to consider that both N-terminal and C-terminal tags might interfere with protein function or localization, so both configurations should be tested .

How can post-translational modifications of Sb10g008220 be identified and characterized?

Post-translational modifications (PTMs) of Sb10g008220 may play crucial roles in its function and regulation. Several approaches can be employed to identify and characterize these modifications:

• Mass spectrometry-based proteomics, particularly liquid chromatography-tandem mass spectrometry (LC-MS/MS), can identify specific PTMs and their sites

• Western blotting with modification-specific antibodies (e.g., for phosphorylation, ubiquitination)

• In vitro modification assays using purified enzymes and recombinant Sb10g008220

• Mobility shift assays to detect changes in protein migration due to modifications

When analyzing PTMs, it's important to compare the recombinant protein produced in E. coli with the native protein from Sorghum bicolor, as the bacterial expression system may lack the enzymes necessary for plant-specific modifications . Additionally, different extraction and purification conditions might preserve or disrupt certain modifications, so multiple approaches should be employed for comprehensive characterization.

How can protein aggregation of Sb10g008220 be minimized during expression and purification?

Preventing aggregation of membrane proteins like Sb10g008220 requires careful optimization at multiple steps:

• Expression optimization: Lower induction temperatures (16-25°C) can slow protein production and allow proper folding. Reducing IPTG concentration from the standard 1 mM to 0.1-0.5 mM can also improve solubility .

• Buffer optimization: Including mild detergents and stabilizing agents in extraction and purification buffers is crucial. A typical buffer might contain:

  • 20-50 mM Tris-HCl (pH 7.5-8.0)

  • 150-300 mM NaCl

  • 5-10% glycerol

  • 0.1-1% appropriate detergent (DDM, CHAPS, or Triton X-100)

  • 1-5 mM reducing agent (DTT or β-mercaptoethanol)

• Purification strategy: Using a gradient elution during IMAC rather than a step elution can help separate properly folded protein from aggregates.

• Post-purification handling: Avoiding concentration to very high levels, using centrifugal filters with appropriate molecular weight cutoffs, and including stabilizing additives can minimize aggregation after purification .

How can the solubility and functionality of recombinant Sb10g008220 be confirmed?

Confirming the solubility and functionality of recombinant Sb10g008220 involves multiple complementary approaches:

• Solubility assessment:

  • Size exclusion chromatography to distinguish between monomeric protein and aggregates

  • Dynamic light scattering (DLS) to measure particle size distribution

  • Ultracentrifugation to separate soluble and insoluble fractions

• Structural integrity:

  • Circular dichroism (CD) spectroscopy to assess secondary structure

  • Fluorescence spectroscopy to examine tertiary structure

  • Limited proteolysis to probe folding quality

• Functional assays:

  • Lipid binding assays if Sb10g008220 interacts with specific lipids

  • Reconstitution into liposomes or nanodiscs followed by functional tests

  • In vitro interaction studies with known binding partners

It's important to establish appropriate positive and negative controls for each assay, particularly using related proteins with known behavior or deliberately denatured samples of Sb10g008220.

What strategies can address poor expression yield of recombinant Sb10g008220?

Poor expression yield of recombinant Sb10g008220 can be addressed through systematic optimization:

• Strain selection: Testing multiple E. coli strains specialized for membrane proteins, such as C41(DE3), C43(DE3), or Lemo21(DE3) .

• Codon optimization: Adapting the Sorghum bicolor gene sequence to E. coli codon usage preferences to enhance translation efficiency.

• Media optimization: As shown in comparative studies, medium composition significantly affects recombinant protein yield. Power Broth™ and Hyper Broth™ have demonstrated superior results for membrane proteins compared to standard media :

  Media Type	Relative Yield Enhancement	Implementation Difficulty
  Glucose M9Y	Base level	Easy
  LB Broth	1-2× increase	Easy
  Hyper Broth™	3-5× increase	Moderate
  Power Broth™	5-10× increase	Moderate
  Superior Broth™	2-4× increase	Moderate
  Turbo Broth™	2-5× increase	Moderate

• Induction parameters: Optimizing cell density at induction (OD600 of 0.6-0.8), IPTG concentration (0.1-1.0 mM), and post-induction temperature (16-37°C) .

• Co-expression strategies: Including chaperones or fusion partners known to enhance membrane protein expression.

For systematic optimization, a factorial experimental design approach is recommended to efficiently identify optimal conditions with the minimum number of experiments .

How can the purity and identity of recombinant Sb10g008220 be verified?

Verifying the purity and identity of recombinant Sb10g008220 requires multiple analytical techniques:

• SDS-PAGE analysis: To assess purity and apparent molecular weight. The expected size of Sb10g008220 with an N-terminal 10xHis-tag is approximately 21-22 kDa .

• Western blotting: Using anti-His antibodies to confirm the presence of the tagged protein.

• Mass spectrometry:

  • MALDI-TOF for intact mass analysis to confirm the expected molecular weight

  • LC-MS/MS following tryptic digestion for peptide mapping and sequence coverage analysis

• N-terminal sequencing: To confirm the correct start of the protein sequence and the integrity of the His-tag.

• Size exclusion chromatography: To assess homogeneity and oligomeric state.

Each batch of purified Sb10g008220 should undergo these quality control measures to ensure consistency between preparations. Acceptance criteria should include minimum purity (typically >90% by SDS-PAGE), correct molecular weight (within 0.1% of theoretical), and sequence coverage (>80% by peptide mapping) .

What are the best methods for quantifying recombinant Sb10g008220 protein concentration?

Accurate quantification of recombinant Sb10g008220 requires consideration of its membrane protein nature and potential interference factors:

• UV absorbance at 280 nm: Using the calculated extinction coefficient based on aromatic amino acid content. For Sb10g008220, the theoretical extinction coefficient can be calculated from its amino acid sequence .

• BCA or Bradford assay: When using these colorimetric methods, it's essential to construct a standard curve using a similar membrane protein rather than a soluble protein like BSA, as detergents can affect the assay response.

• Amino acid analysis: This provides the most accurate quantification but is more labor-intensive and expensive.

• Quantitative densitometry: Comparing band intensity on SDS-PAGE to known standards.

For maximum accuracy, it's recommended to use at least two independent methods and cross-validate the results. Additionally, the presence of detergents can interfere with many protein quantification methods, so appropriate controls and blanks must be included .

How can the batch-to-batch consistency of recombinant Sb10g008220 be ensured?

Ensuring batch-to-batch consistency is critical for reliable experimental results. A comprehensive quality control program should include:

• Standardized production protocol: Documenting and strictly following optimized expression and purification protocols.

• Critical quality attributes (CQAs): Defining specifications for key parameters including:

  • Purity (>90% by SDS-PAGE and SEC-HPLC)

  • Identity (confirmed by Western blot and mass spectrometry)

  • Concentration (determined by multiple methods)

  • Activity/functionality (using established functional assays)

• Certificate of Analysis (CoA): Creating a detailed document for each batch that records all quality parameters and test results.

• Reference standard: Maintaining a well-characterized reference sample for comparative analysis.

• Stability studies: Monitoring protein quality under storage conditions to establish expiration dates.

Implementation of these quality control measures will minimize variability between experiments and ensure reliable, reproducible research outcomes when working with Sb10g008220 .