Recombinant Sorghum bicolor Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Sorghum bicolor Chloroplast Envelope Membrane Protein (cemA)

Recombinant Sorghum bicolor Chloroplast envelope membrane protein (cemA) is a genetically engineered variant of the native cemA protein, produced using an Escherichia coli (E. coli) expression system. This transmembrane protein plays a critical role in chloroplast membrane integrity and function, particularly in ion transport and stress response mechanisms . The recombinant form is tagged with a 10xHis sequence at the N-terminus for purification and detection purposes, ensuring high specificity in experimental applications such as enzyme-linked immunosorbent assays (ELISA) .

Genomic Context

The cemA gene is part of the Sorghum bicolor chloroplast genome, which spans 140,644–140,754 bp and includes 103 genes . Comparative analyses of chloroplast genomes revealed polymorphisms in the cemA-petA intergenic region, such as a 22 bp insertion/deletion (InDel) used to distinguish cytoplasmic male sterility (CMS) types .

Table 1: Key Genomic Features of cemA

FeatureDetail
Gene IDcemA
UniProt IDA1E9T6
Protein Length230 amino acids
Genomic LocationChloroplast genome, intergenic region cemA-petA
Associated TraitsCytoplasmic male sterility, chloroplast membrane integrity

Role in Cytoplasmic Male Sterility (CMS)

Studies identified a 22 bp InDel marker in the cemA-petA region, enabling precise differentiation between CMS-S (male-sterile) and CMS-N (male-fertile) cytotypes in Sorghum bicolor . This marker, validated in 1,104 Korean cultivars, confirmed that CMS-S lines exclusively carry the 22 bp insertion, facilitating breeding programs for hybrid vigor .

Recombinant Protein Production

The recombinant cemA protein is expressed in E. coli and purified using affinity chromatography. Key specifications include:

  • Storage: -20°C (short-term) or -80°C (long-term) in Tris-based buffer with 50% glycerol .

  • Purity: >90% as confirmed by SDS-PAGE .

  • Applications: ELISA, antibody production, and structural studies of chloroplast membrane dynamics .

Table 2: Recombinant cemA Production Details

ParameterSpecification
Expression SystemE. coli
TagN-terminal 10xHis
Molecular Weight~25 kDa (predicted)
StabilityAvoid repeated freeze-thaw cycles; working aliquots stable at 4°C for 1 week

Genetic and Evolutionary Insights

Whole-genome resequencing of Sorghum bicolor and its hybrids with S. halepense revealed that cemA resides in conserved regions of the chloroplast genome, showing minimal structural variation compared to nuclear genes . Phylogenetic analyses placed cemA within a clade shared with wild relatives like S. propinquum, highlighting its evolutionary conservation in Poaceae .

Future Directions

Further research is needed to elucidate cemA’s role in abiotic stress tolerance and its interaction with other chloroplast membrane proteins. The development of RNAi or CRISPR-edited cemA mutants could provide functional insights, while recombinant variants may aid in biotechnological applications such as biofuel production .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include them in your order notes. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize development with the specified tag.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Sorghum bicolor (Sorghum) (Sorghum vulgare)
Target Names
cemA
Target Protein Sequence
MKKKKALPSFLYLVFIVLLPWGVSFSFNKCLELWIKNWWNTRQSETFLTDIQEKRILEGF IELEELFLLDEMIKEKPKTHVQKLPIGIHKEIIQLAKIDNEDHLHIILHFSTNIICLAIL SGSFFLGKEELVILNSWVQEFFYNLNDSIKAFFILLVTDFFVGFHSTRGWELLIRWVYNN LGWAPNELIFTIFVCSFPVILDTCLKFWVFFCLNRLSPSLVVIYHSISEA
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion. It indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Database Links

KEGG: sbi:4549171

Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is cemA and what is its function in Sorghum bicolor?

cemA (chloroplast envelope membrane protein A) is a gene located in the chloroplast genome of plants, including Sorghum bicolor. The protein encoded by cemA is believed to be involved in CO₂ uptake mechanisms or proton extrusion across the chloroplast envelope membrane, which affects photosynthetic efficiency. In Sorghum bicolor, a C4 photosynthetic plant, the cemA protein likely plays a critical role in carbon concentrating mechanisms that enable efficient photosynthesis under high temperature and drought conditions.

Research on chloroplast envelope membranes has identified numerous proteins that perform various functions in chloroplast biogenesis, metabolism, and communication with other cellular compartments. In Arabidopsis, for example, 117 proteins have been identified or predicted to be in the outer membrane of the chloroplast envelope . These proteins participate in intracellular communication, organelle biogenesis, import and export of ions and metabolites, import of nuclear-encoded proteins, and various metabolic processes including membrane lipid biosynthesis .

How is the genetic structure of Sorghum bicolor relevant to cemA studies?

Sorghum bicolor has a well-characterized genetic structure that supports studies of chloroplast proteins. Genetic mapping studies of Sorghum bicolor × Sorghum propinquum recombinant inbred lines (RILs) have identified 141 loci across 10 linkage groups spanning 773.1 cM . This genetic map has DNA marker density well-suited to quantitative trait loci mapping .

An important consideration for genetic studies is that the vast majority of recombination in sorghum is concentrated in small regions of euchromatin that are distal to most chromosomes, while pericentromeric heterochromatin is recalcitrant to recombination . This genetic architecture affects strategies for gene mapping and trait association studies involving chloroplast-related genes.

The S. bicolor × S. propinquum RIL population offers significant advantages for genetic studies as it segregates for many traits related to plant architecture, growth and development, reproduction, and life history . These genetic resources can be leveraged for understanding genetic factors that may influence cemA expression and function.

What isolation techniques are effective for chloroplast envelope membrane proteins in Sorghum?

Table 1: Methods for Isolation and Analysis of Chloroplast Envelope Membrane Proteins

TechniqueApplicationAdvantagesLimitations
Differential centrifugationInitial chloroplast isolationSimple, widely accessibleLow purity
Percoll gradient separationPurification of intact chloroplastsHigh purity of intact chloroplastsTime-consuming
Two-phase partitioningEnvelope membrane isolationSelective enrichment of envelope membranesTechnical complexity
Biotin taggingTopology studiesMaps protein orientation in membraneRequires optimization for specificity
Proteolysis techniquesStructural analysisDetermines exposed protein domainsCan be affected by native proteases
Detergent solubilizationMembrane protein extractionEffective for hydrophobic proteinsMay disrupt protein-protein interactions

For chloroplast envelope membrane proteins like cemA, biotin tagging and proteolysis techniques have been applied to examine topology and membrane association, although these approaches still require refinement to achieve the desired specificity . The process typically involves:

  • Isolation of intact chloroplasts using density gradient centrifugation

  • Membrane fractionation to separate envelope membranes from thylakoids

  • Protein extraction using detergent-based methods optimized for membrane proteins

  • Analysis using techniques such as mass spectrometry or Western blotting

How do chloroplast outer membrane proteins navigate between organelles?

The chloroplast outer membrane contains proteins that facilitate communication between organelles. Interestingly, 16 proteins found in the mitochondria outer membrane are also present in the chloroplast outer envelope membrane, suggesting shared targeting mechanisms and functions between these two organelles .

Chloroplast outer membrane proteins exhibit different topologies and insertion mechanisms:

  • Single-pass transmembrane proteins: These can have either N cytosol-C intermembrane space (for signal-anchored) or N intermembrane space-C cytosol (for tail-anchored) orientation .

  • β-Barrel proteins: These integrate into the membrane via multiple transmembrane β-strands, requiring evolutionarily conserved machinery in the membrane .

The most-studied chloroplast outer membrane proteins are subunits of the TOC (translocon at the outer-envelope-membrane of chloroplasts) machinery, which imports nuclear-encoded precursor proteins from the cytosol. Key components include:

  • GTPases Toc159 and Toc34, which recognize precursors and regulate import

  • Toc75, which forms a protein-conducting channel

In Arabidopsis, there are four Toc159 isoforms showing substrate selectivity, two catalytically redundant Toc34 isoforms, and one functional Toc75 . This diversity suggests specialized functions that may also be present in Sorghum bicolor.

What expression systems are optimal for recombinant production of Sorghum bicolor cemA?

Table 2: Comparison of Expression Systems for Recombinant cemA Production

Expression SystemAdvantagesLimitationsBest Applications
E. coliHigh yield, simple cultivationLimited post-translational modificationsStructural studies, antibody production
Yeast (Pichia pastoris)Eukaryotic processing, high densityLonger cultivation timeFunctional studies requiring glycosylation
Insect cellsComplex eukaryotic modificationsHigher cost, technical complexityStructural biology, transport studies
Plant cell culturesNative-like modificationsLower yieldsFunctional assays in near-native condition
Transient expression (N. benthamiana)Rapid results, plant-specific modificationsVariable expressionLocalization studies, protein-protein interactions
Stable transformation (Arabidopsis)Consistent expressionTime-consumingLong-term physiological studies

When selecting an expression system, researchers should consider:

  • The purpose of the recombinant protein (structural vs. functional studies)

  • Required post-translational modifications

  • Necessary yield

  • Time and resource constraints

For membrane proteins like cemA, specialized E. coli strains (C41/C43) designed for membrane protein expression often provide a good starting point. For more complex studies examining protein-protein interactions or physiological effects, plant-based expression systems may be more appropriate.

How can whole-genome resequencing approaches benefit cemA research in Sorghum?

Whole-genome resequencing of Sorghum bicolor and related species provides powerful tools for cemA research. A recent study on a panel of 172 populations of S. bicolor and S. bicolor × S. halepense (SbxSh) advanced lines generated:

  • 567,046,841 SNPs

  • 91,825,474 indels

  • 1,532,171 SVs

  • 4,973,961 CNVs

SbxSh lines accumulated more variants and mutations with powerful effects on genetic differentiation . By mining these data, researchers can:

  • Identify natural variations in cemA across Sorghum species

  • Correlate sequence variations with functional differences

  • Discover regulatory elements affecting cemA expression

  • Identify interacting proteins through co-evolution patterns

The whole-genome resequencing approach is particularly valuable as it provides comprehensive genetic information that can drive hypothesis generation about cemA function and regulation in different Sorghum genetic backgrounds.

What genetic transformation approaches are most effective for cemA studies in Sorghum?

For functional studies of cemA in Sorghum bicolor, several genetic transformation approaches can be employed:

  • Agrobacterium-mediated transformation:

    • Allows for stable introduction of recombinant cemA constructs

    • Can support overexpression, fluorescent tagging, or promoter studies

    • Typically targets nuclear genome for expression of recombinant proteins

  • Biolistic transformation:

    • Direct DNA delivery via particle bombardment

    • Particularly useful for chloroplast transformation

    • Can introduce constructs directly to the chloroplast genome where native cemA resides

  • CRISPR/Cas9 genome editing:

    • Enables precise modifications to cemA or related genes

    • Can create knockout lines or introduce specific mutations

    • Useful for studying structure-function relationships

  • RNAi approaches:

    • Allow for knockdown rather than knockout

    • Useful when complete loss of cemA function might be lethal

    • Can be designed with inducible promoters for temporal control

The choice of approach depends on research objectives, available resources, and whether targeting the nuclear or chloroplast genome is more appropriate for the specific study goals.

How can proteomics approaches advance understanding of cemA interactions?

Advanced proteomics techniques can reveal cemA protein interactions and post-translational modifications, providing insights into its functional role in the chloroplast envelope membrane:

  • Co-immunoprecipitation coupled with mass spectrometry:

    • Identifies proteins that physically interact with cemA

    • Requires antibodies specific to cemA or epitope tags on recombinant constructs

  • Crosslinking mass spectrometry (XL-MS):

    • Captures transient protein-protein interactions

    • Maps interaction interfaces at amino acid resolution

  • Proximity labeling techniques (BioID, APEX):

    • Identifies proteins in the vicinity of cemA in vivo

    • Does not require stable interactions, capturing the protein neighborhood

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps conformational changes in cemA under different conditions

    • Provides insights into functional mechanisms

These techniques can be applied to both native cemA in isolated chloroplasts and recombinant cemA expressed in various systems, providing complementary information about protein function and interactions.

How should researchers design primers for cemA amplification and cloning?

Effective primer design for cemA amplification requires consideration of several factors:

Table 3: Primer Design Considerations for cemA Amplification

ConsiderationRecommendationRationale
Template specificityInclude 18-25 bp complementary to targetEnsures specific amplification
GC contentMaintain 40-60% GCProvides stable annealing
Tm (melting temperature)Design primers with similar TmOptimizes PCR conditions
Secondary structuresAvoid self-complementary sequencesPrevents primer dimers
5' extensionsAdd restriction sites with 4-6 bp overhangsFacilitates cloning
Codon optimizationAdjust codons for expression systemImproves protein expression

For chloroplast genes like cemA, consider:

  • The high AT content typical of chloroplast genomes

  • The presence of inverted repeats that may complicate primer specificity

  • The need to distinguish between nuclear and chloroplast versions if both exist

For recombinant expression, primers should incorporate:

  • Appropriate restriction sites flanked by 4-6 nucleotides

  • Required in-frame fusions with tags or reporter proteins

  • Removal of transit peptides if expressing mature protein only

What controls should be included in cemA functional assays?

When designing functional assays for recombinant cemA, appropriate controls are essential:

  • Positive controls:

    • Well-characterized chloroplast envelope proteins with known functions

    • Proteins with similar topological features as cemA

    • Previously characterized cemA from related species

  • Negative controls:

    • Empty vector controls

    • Inactive mutant versions of cemA

    • Unrelated membrane proteins that should not show cemA-specific activity

  • Experimental validation controls:

    • Western blots confirming expression and correct size

    • Localization studies confirming proper membrane targeting

    • Topology assays confirming correct orientation in the membrane

  • Technical controls:

    • Multiple biological and technical replicates

    • Randomized experimental design

    • Blinded analysis where appropriate

These controls help validate experimental findings and distinguish genuine cemA functions from artifacts or general membrane protein effects.

How can researchers overcome challenges in cemA membrane protein crystallization?

Membrane protein crystallization presents significant challenges that researchers must address for structural studies of cemA:

  • Protein preparation strategies:

    • Use specialized detergents (DDM, LMNG, GDN) for extraction

    • Consider native nanodiscs or styrene maleic acid copolymer lipid particles (SMALPs)

    • Employ lipidic cubic phase (LCP) crystallization methods

  • Construct optimization:

    • Remove flexible regions that impede crystallization

    • Create fusion proteins with crystallization chaperones (T4 lysozyme, BRIL)

    • Test multiple orthologs from different species (thermostable homologs often crystallize better)

  • Alternative structural approaches:

    • Cryo-electron microscopy for structure determination without crystals

    • Solid-state NMR for structural information in membrane environment

    • Computational modeling based on homologous proteins

  • Biochemical validation:

    • Verify protein homogeneity by size-exclusion chromatography

    • Confirm functionality before and after purification

    • Assess thermal stability through differential scanning fluorimetry

These approaches have successfully been applied to other chloroplast membrane proteins and can be adapted for structural studies of cemA.

What bioinformatic tools are most useful for cemA sequence and structure analysis?

Table 4: Bioinformatic Tools for cemA Analysis

Analysis TypeRecommended ToolsApplication
Sequence alignmentMUSCLE, CLUSTALW, T-CoffeeComparing cemA across species
Phylogenetic analysisMEGA, RAxML, MrBayesEvolutionary relationships
Transmembrane predictionTMHMM, Phobius, TOPCONSMembrane topology
Signal peptide predictionSignalP, ChloroP, TargetPTransit peptide identification
Protein structure predictionAlphaFold2, RoseTTAFold3D structure modeling
Protein-protein interactionSTRING, PSICQUICInteraction network analysis
Protein domain analysisPfam, InterPro, SMARTFunctional domain identification
Codon usage analysisCodonW, GCUAOptimization for expression

For a comprehensive analysis workflow:

  • Start with sequence retrieval from chloroplast genome databases

  • Perform multiple sequence alignments to identify conserved regions

  • Predict protein topology and transmembrane regions

  • Identify functional domains and motifs

  • Generate 3D structural models

  • Analyze conservation patterns in the context of the structural model

  • Predict potential interaction partners

This bioinformatic pipeline provides a foundation for hypothesis generation and experimental design for cemA functional studies.

How might cemA function contribute to drought resistance in Sorghum bicolor?

Sorghum bicolor is known for its drought tolerance, and cemA may play a role in this adaptation. Future research directions should explore:

  • Comparative expression analysis:

    • Measure cemA expression levels under varying water availability

    • Compare expression patterns between drought-tolerant and drought-sensitive varieties

    • Correlate cemA sequence variations with drought tolerance phenotypes

  • Physiological studies:

    • Examine CO₂ uptake efficiency in plants with modified cemA expression

    • Measure photosynthetic parameters under drought stress

    • Investigate chloroplast membrane integrity during water limitation

  • Genetic engineering approaches:

    • Create cemA overexpression lines to test for enhanced drought tolerance

    • Engineer cemA variants based on sequences from extremely drought-tolerant Sorghum species

    • Develop CRISPR/Cas9 modified lines with altered cemA function

  • Integration with whole-plant physiology:

    • Connect cemA function to root development and drought responses

    • Examine potential roles in water use efficiency

    • Investigate interactions with known drought response pathways

The genetic resources available, including the S. bicolor × S. propinquum RIL population described in the search results , provide valuable material for these studies.

How does cemA interact with other chloroplast envelope proteins in Sorghum?

Understanding cemA's interactions with other chloroplast envelope proteins is crucial for elucidating its function:

  • Interactome mapping:

    • Perform co-immunoprecipitation with tagged cemA

    • Use yeast two-hybrid or split-ubiquitin assays adapted for membrane proteins

    • Apply proximity labeling techniques to identify neighboring proteins

  • Functional complex characterization:

    • Isolate intact protein complexes containing cemA

    • Determine composition and stoichiometry through native mass spectrometry

    • Characterize the function of reconstituted complexes in liposomes

  • Genetic interaction studies:

    • Create double mutants affecting cemA and potential interacting partners

    • Look for synthetic phenotypes indicating functional relationships

    • Perform genetic suppressor screens to identify compensatory mutations

This research would build upon our understanding of chloroplast outer membrane proteins, particularly the TOC machinery components , which may functionally interact with cemA.

What can comparative genomics reveal about cemA evolution in Sorghum species?

The whole-genome resequencing of Sorghum bicolor and S. halepense generated extensive variant data that could inform comparative genomics studies of cemA :

  • Sequence variation analysis:

    • Compare cemA sequences across Sorghum species and varieties

    • Identify signatures of selection in different lineages

    • Correlate sequence variations with environmental adaptations

  • Synteny and genome organization:

    • Examine conservation of genomic regions surrounding cemA

    • Identify potential regulatory elements through phylogenetic footprinting

    • Investigate chloroplast genome rearrangements affecting cemA expression

  • Transcriptional regulation:

    • Compare promoter regions and expression patterns across species

    • Identify cis-regulatory elements through comparative genomics

    • Correlate regulatory variations with expression differences

  • Protein structure implications:

    • Model structural consequences of amino acid substitutions

    • Identify co-evolving residues suggesting functional interactions

    • Predict effect of variations on protein stability and function

These approaches would leverage the extensive genomic data available for Sorghum species to provide evolutionary context for cemA function.

How can CRISPR/Cas technologies advance cemA functional studies?

CRISPR/Cas technologies offer powerful approaches for cemA functional studies:

  • Gene editing applications:

    • Create precise mutations to test structure-function hypotheses

    • Generate knockout lines to assess cemA essentiality

    • Introduce tags for tracking native cemA expression and localization

  • Transcriptional modulation:

    • Use CRISPR interference (CRISPRi) for targeted gene silencing

    • Apply CRISPR activation (CRISPRa) for upregulation studies

    • Develop inducible systems for temporal control

  • Base and prime editing:

    • Introduce specific amino acid changes without double-strand breaks

    • Create libraries of cemA variants for functional screening

    • Repair potentially deleterious natural variants

  • High-throughput screening:

    • Generate CRISPR libraries targeting cemA and related genes

    • Screen for phenotypes related to photosynthetic efficiency

    • Identify genetic interactions through combinatorial targeting

These approaches would complement classical genetic resources like the recombinant inbred lines described in the search results , offering more precise genetic manipulation capabilities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.