Recombinant Sorghum bicolor Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Sorghum bicolor (Sorghum) (Sorghum vulgare)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPTGLLTVPFLENVNKF QNPFRRPVATTVFLIGTVVALWLGIGATLPIDKSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of the petD subunit in the Cytochrome b6-f complex?

The petD gene encodes subunit IV of the Cytochrome b6-f complex, which is a critical component in the photosynthetic electron transfer chain that links Photosystem I and Photosystem II. The complex catalyzes the transfer of electrons from plastoquinol to plastocyanin while simultaneously pumping protons into the thylakoid space, contributing to the generation of an electrochemical gradient used for ATP synthesis . Recent research has demonstrated that the N-terminal region of PetD is essential for cytochrome b6f function, playing a crucial role in maintaining structural integrity and electron transport efficiency .

What is the structural composition of the Cytochrome b6-f complex?

The Cytochrome b6-f complex is a dimeric protein with each monomer composed of eight subunits. These include four large subunits:

  • A 32 kDa cytochrome f with a c-type cytochrome

  • A 25 kDa cytochrome b6 with low- and high-potential heme groups

  • A 19 kDa Rieske iron-sulfur protein containing a [2Fe-2S] cluster

  • A 17 kDa subunit IV (encoded by petD)

Additionally, there are four small subunits (3-4 kDa): PetG, PetL, PetM, and PetN. The total molecular weight of the complex is approximately 217 kDa . Crystal structures have been determined from several organisms, including Chlamydomonas reinhardtii, Mastigocladus laminosus, and Nostoc sp. PCC 7120 .

Why is Sorghum bicolor a valuable model organism for studying photosynthetic proteins?

Sorghum bicolor is a photosynthetically efficient C4 grass that serves as an important source of grain, forage, fermentable sugars, and cellulosic fibers . As a drought-resistant crop with diverse carbon-partitioning regimes, Sorghum provides an excellent model for studying photosynthetic efficiency and carbon fixation. Its genome has been sequenced and well-characterized, facilitating genetic studies and making it particularly valuable for investigating the genetic architecture underlying carbon partitioning . Additionally, Sorghum's non-GMO status and environmental adaptability make it an attractive system for sustainable agriculture research .

What expression systems are most effective for recombinant production of plant membrane proteins like petD?

For expressing membrane proteins like petD from the Cytochrome b6-f complex, the pET expression system has proven particularly effective. This system utilizes T7 RNA polymerase to direct the expression of target genes cloned into pET vectors . The procedure typically involves:

  • Cloning the petD gene into a suitable pET vector (e.g., pET-21d+)

  • Transforming the construct into an E. coli expression host (typically BL21(DE3) or derivatives)

  • Inducing expression with IPTG to activate the T7 promoter

  • Optimizing growth conditions to enhance protein production

For membrane proteins like petD, special considerations include using strains like C41(DE3) or C43(DE3) that are better adapted for membrane protein expression, and incorporating detergents during extraction to maintain protein solubility and function .

What purification strategies yield the highest activity for recombinant Cytochrome b6-f complex components?

Based on successful purification of the Cytochrome b6-f complex from green algae, an optimized three-step protocol can be adapted for the Sorghum bicolor petD subunit:

  • Selective solubilization from thylakoid membranes: Using neutral detergents such as Hecameg (6-O-(N-heptylcarbamoyl)-methyl-alpha-D-glycopyranoside) at carefully controlled concentrations to extract the membrane protein without denaturation

  • Density gradient ultracentrifugation: Separation using sucrose gradient sedimentation to isolate the protein complex based on size and density

  • Chromatographic purification: Final purification using hydroxylapatite chromatography or immobilized metal affinity chromatography if the recombinant protein contains a histidine tag

The purified complex should be assessed for integrity by measuring spectrophotometric properties characteristic of the b and f hemes, as well as evaluating electron transfer activity using decylplastoquinol and oxidized plastocyanin as substrates .

How can site-directed mutagenesis be employed to study the functional domains of the petD protein?

Site-directed mutagenesis provides powerful insights into structure-function relationships within the petD protein. A methodical approach includes:

  • Target selection: Identify conserved residues through sequence alignment across species using tools like PDBsum server to identify highly conserved regions (shown in red) versus poorly conserved regions (blue)

  • Mutagenesis strategy: Create a library of mutants focusing on:

    • N-terminal region modifications, which are essential for complex function

    • Transmembrane domain alterations to assess membrane integration

    • Residues involved in protein-protein interactions within the complex

  • Functional assessment: Evaluate mutants through:

    • Complementation assays in petD-knockout lines

    • Electron transfer kinetics measurements

    • Binding studies with other complex components

    • Thermostability analysis to assess structural integrity

  • In vivo validation: Transform mutant constructs into Sorghum chloroplasts using biolistic transformation with spectinomycin resistance for selection, followed by phenotypic analysis under different light and stress conditions

What techniques are most reliable for assessing the interaction between recombinant petD and other Cytochrome b6-f complex components?

Several complementary approaches can be employed to characterize protein-protein interactions:

  • Co-immunoprecipitation (Co-IP): Using antibodies against petD or epitope tags to pull down interacting partners

  • Western blot analysis: Utilize PVDF membrane transfer of purified complexes followed by detection with specific antibodies such as:

    • Primary antibody: Penta-His Antibidy (1:1000 dilution in PBS with 1% BSA)

    • Secondary antibody: Goat Anti-Mouse IgG HRP conjugate

    • Development using chromogenic substrates

  • Surface plasmon resonance (SPR): Quantitative measurement of binding kinetics between petD and other subunits

  • Crosslinking mass spectrometry: Identification of spatial relationships between interacting proteins within the complex

  • Fluorescence resonance energy transfer (FRET): Assessment of protein proximity in reconstituted systems

A combination of these methods provides robust evidence for specific interactions and their functional significance.

How can advanced imaging techniques be applied to study the Cytochrome b6-f complex containing recombinant petD?

Modern structural biology techniques offer unprecedented insights into membrane protein complexes:

  • Cryo-electron microscopy (Cryo-EM): Near-atomic resolution imaging of the entire complex without crystallization

  • Single-particle analysis: Computational approaches to generate 3D reconstructions from multiple 2D images

  • Molecular dynamics simulations: Prediction of structural changes under different conditions based on experimental data

  • Atomic force microscopy (AFM): Topographical imaging of the complex in native-like membrane environments

  • Fluorescence microscopy with protein tagging: Visualization of complex assembly and localization within chloroplasts

What genomic resources are available for studying petD variations in Sorghum bicolor?

Several genomic resources facilitate the study of petD in Sorghum bicolor:

  • Reference genome: The complete Sorghum bicolor v3.1.1 genome available through Phytozome provides the foundation for genetic studies

  • RNA-seq datasets: Transcriptomic data showing expression patterns of petD across different tissues and conditions

  • Nested Association Mapping (NAM) populations: The 11-family NAM population with corresponding genomic data enables genetic mapping of traits related to photosynthetic efficiency

  • Mini-core collections: The Sorghum mini-core collection comprising diverse genotypes has been extensively characterized for genetic structure and linkage disequilibrium

  • SNP datasets: Large collections of SNP markers (over 6 million) enable genome-wide association studies to identify loci affecting photosynthetic traits

These resources can be leveraged to identify natural variations in petD and correlate them with phenotypic differences in photosynthetic efficiency across diverse Sorghum genotypes.

How can CRISPR-Cas9 gene editing be optimized for studying petD function in Sorghum bicolor?

CRISPR-Cas9 gene editing of chloroplast genes like petD requires specialized approaches:

  • Targeting strategy:

    • Design sgRNAs specific to the petD sequence using chloroplast genome-specific tools

    • Create constructs that target both the N-terminal region and functional domains

    • Include PAM sequences compatible with the Cas9 variant used

  • Delivery method:

    • Biolistic transformation is most effective for chloroplast genome modification

    • Co-deliver the Cas9, sgRNA, and repair template on gold particles

    • Include selectable markers like the aminoglycoside adenyl transferase (aadA) cassette for spectinomycin resistance

  • Selection and verification:

    • Screen transformants on spectinomycin (150 μg/ml) media

    • Replate several times to obtain homoplastic strains (with all chloroplast genome copies edited)

    • Verify edits by PCR amplification and sequencing

  • Phenotypic analysis:

    • Assess photoautotrophic growth under different light intensities

    • Measure photosynthetic electron transport rates

    • Analyze state transitions and other photosynthetic parameters

What experimental design is most effective for quantifying petD expression across different Sorghum genotypes and environmental conditions?

A comprehensive experimental approach would include:

Table 1: Experimental Design for Quantifying petD Expression

FactorLevelsMeasurementsAnalysis Method
GenotypesDiverse Sorghum lines (grain, sweet, forage, biomass types)RT-qPCR of petD, Western blot, ProteomicsANOVA, PCA
Developmental stagesSeedling, vegetative, flowering, grain fillingTranscript abundance, Protein levelsTime-series analysis
Light conditionsLow (50 μmol m⁻² s⁻¹), Medium (250 μmol m⁻² s⁻¹), High (500 μmol m⁻² s⁻¹)Photosynthetic parameters, Gene expressionTwo-way ANOVA
Stress treatmentsDrought, Heat, Combined stressPhysiological measurements, Expression profilesStress response index
Carbon partitioningVaried source-sink relationshipsCarbohydrate content, Gene expressionCorrelation analysis

The experimental design should incorporate:

  • Controlled environments: Growth chambers with precise control of temperature, humidity, and photoperiod

  • Randomized complete block design: Minimum three biological replicates with appropriate statistical power

  • Reference genes: Carefully validated internal controls for expression normalization

  • Mixed-methods approach: Combining quantitative (RT-qPCR, proteomics) and qualitative (localization studies) techniques

What spectroscopic methods are most informative for characterizing recombinant petD and assembled Cytochrome b6-f complex?

Multiple spectroscopic techniques provide complementary information:

  • UV-Visible absorption spectroscopy: Characteristic peaks for:

    • Cytochrome f (α band at 554 nm; Em,8 = +330 mV)

    • Cytochrome b6 (α bands at 564 nm; Em,8 = -84 and -158 mV)

    • Chlorophyll a (λmax = 667-668 nm)

  • Fluorescence spectroscopy: Monitors protein folding and tertiary structure integrity

  • Circular dichroism (CD): Assessment of secondary structure composition

  • Electron paramagnetic resonance (EPR): Detection of paramagnetic centers including iron-sulfur clusters

  • Resonance Raman spectroscopy: Provides information about heme environments and protein interactions

Kinetic measurements of electron transfer activity using decylplastoquinol and oxidized plastocyanin should show turnover numbers of approximately 250-300 s⁻¹ for fully functional complexes .

How can researchers distinguish between effects of mutations on petD assembly versus catalytic function?

Differentiating assembly defects from functional impairments requires a systematic approach:

  • Assembly assessment:

    • Blue native PAGE to analyze intact complex formation

    • Size-exclusion chromatography to determine complex integrity

    • Immunoblotting to quantify subunit stoichiometry

    • Sucrose gradient ultracentrifugation to assess complex stability

  • Functional analysis:

    • Electron transfer assays to measure catalytic activity

    • Proton pumping assays to assess electrochemical gradient formation

    • State transition measurements to evaluate dynamic regulation

    • Quantum yield determination to quantify photosynthetic efficiency

  • Comparative analysis:

    • Calculate activity per assembled complex to normalize for assembly differences

    • Perform temperature sensitivity assays to detect subtle structural defects

    • Use chemical crosslinking to assess protein-protein interactions within the complex

This multifaceted approach allows researchers to determine whether mutations primarily affect assembly, stability, or the catalytic mechanism itself.

How can metabolic engineering approaches utilize petD modifications to enhance photosynthetic efficiency in Sorghum?

Metabolic engineering strategies targeting petD could improve photosynthetic efficiency through:

  • Optimizing electron transport rates: Modifications to the N-terminal region of petD to enhance electron flow between photosystems

  • Reducing photoinhibition: Engineering variants with improved recovery from high light stress

  • Enhancing carbon fixation: Coordinated modification of electron transport components and carbon assimilation pathways

  • Improving stress tolerance: Developing variants that maintain function under drought or temperature stress

Researchers should evaluate engineered lines using a combination of gas exchange measurements, chlorophyll fluorescence imaging, and growth performance under field conditions. Principal component analysis of agronomic traits can help identify correlations between photosynthetic parameters and yield components like those illustrated in research on Sorghum genotypes .

What challenges exist in translating in vitro findings about recombinant petD to whole-plant photosynthetic performance?

Several key challenges complicate the translation of molecular findings to whole-plant physiology:

  • Stoichiometric balance: Maintaining proper ratios between photosynthetic components when modifying individual proteins

  • Regulatory networks: Accounting for compensatory changes in gene expression and post-translational modifications

  • Environmental interactions: Bridging the gap between controlled laboratory conditions and variable field environments

  • Temporal dynamics: Considering developmental changes in photosynthetic apparatus composition throughout the plant lifecycle

  • Tissue-specific effects: Addressing differences in photosynthetic apparatus composition between leaf types and developmental stages

Researchers can address these challenges through integrated approaches combining molecular techniques with whole-plant physiology measurements and field trials under diverse environmental conditions.

How might artificial intelligence and machine learning accelerate research on the structure-function relationships in petD?

AI and machine learning approaches offer powerful tools for petD research:

  • Protein structure prediction: Using AlphaFold or similar tools to model petD structure and its interactions within the Cytochrome b6-f complex

  • Sequence-function relationships: Employing deep learning to identify patterns in sequence data that correlate with functional properties

  • Literature mining: Utilizing natural language processing to extract relevant information from the vast scientific literature

  • Experimental design optimization: Implementing active learning algorithms to determine the most informative experiments to perform next

  • Multi-omics data integration: Combining genomic, transcriptomic, proteomic, and physiological data to develop comprehensive models of photosynthetic regulation

These computational approaches can guide hypothesis generation and experimental design, potentially reducing the time and resources required to make significant advances in understanding petD function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.