Recombinant Sorghum bicolor Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Sorghum bicolor Cytochrome b6

Recombinant Sorghum bicolor Cytochrome b6 (petB) is a protein encoded by the petB gene in the Sorghum bicolor genome. As a recombinant protein, it is produced through genetic engineering techniques that allow for its expression and purification for research purposes. Cytochrome b6 is a critical component of the cytochrome b6f complex, which plays an essential role in photosynthetic electron transport in plants, including Sorghum bicolor. The protein is identified in the UniProt database with the accession number A1E9V4, providing a standardized reference for researchers studying this specific protein .

Sorghum bicolor, the source organism, is a significant cereal crop globally known for its drought tolerance and versatility. The availability of recombinant proteins from this species, including Cytochrome b6, facilitates detailed molecular studies of its photosynthetic machinery and energy transfer processes.

Comparative Features with Other Plant Species

The Cytochrome b6 protein structure is notably conserved across various plant species. This conservation is evidenced by the cross-reactivity of Cytochrome b6 antibodies across multiple plant species, including Sorghum bicolor. The antibody recognition patterns suggest structural similarities in the protein across diverse plant taxa such as Chlamydomonas reinhardtii, Brassica napus, Nicotiana tabacum, and numerous other species .

Expression Systems and Methodology

Recombinant Sorghum bicolor Cytochrome b6 is typically produced using heterologous expression systems. While the specific expression system for this protein is not explicitly detailed in the available sources, similar recombinant proteins from Sorghum bicolor, such as the Cytochrome C Biogenesis Protein CcsA, are expressed in Escherichia coli systems with appropriate tags for purification purposes .

The recombinant protein may be produced with various tags depending on the specific production process and intended application. These tags facilitate purification and can be designed to optimize protein solubility and stability during the production process .

Purification Protocols

Purification of Recombinant Sorghum bicolor Cytochrome b6 typically employs affinity chromatography techniques when the protein is expressed with specific tags. Standard protocols aim to achieve a purity level greater than 90% as determined by SDS-PAGE analysis, similar to other recombinant proteins from the same organism .

Handling Recommendations

For optimal handling and use of Recombinant Sorghum bicolor Cytochrome b6, the following practices are recommended:

  1. Aliquoting the protein upon receipt to minimize freeze-thaw cycles

  2. Working with aliquots at 4°C for periods up to one week

  3. Using appropriate buffer conditions optimized for the specific protein

  4. Following standard protein handling protocols to minimize degradation

Antibodies and Detection Methods

Anti-Cytochrome b6 antibodies are available as research tools for studying this protein in Sorghum bicolor and other plant species. These antibodies are typically supplied in lyophilized form and demonstrate cross-reactivity with Cytochrome b6 from multiple plant species, including Chlamydomonas reinhardtii, Brassica napus, Nicotiana tabacum, Solanum tuberosum, Medicago truncatula, Hordeum vulgare, Oryza sativa, Triticum aestivum, Panicum virgatum, Sorghum bicolor, and numerous other plant species .

This cross-reactivity makes these antibodies valuable tools for comparative studies of photosynthetic apparatus across different plant taxa. The antibodies can be employed in various techniques, including Western blotting, immunohistochemistry, and ELISA, to detect and quantify Cytochrome b6 in plant samples.

Research Context in Sorghum Biology

While the specific research applications of Recombinant Sorghum bicolor Cytochrome b6 are not extensively detailed in the available sources, the protein's role in photosynthetic electron transport makes it relevant to studies of photosynthetic efficiency, bioenergetics, and stress responses in Sorghum bicolor.

Research on other cytochrome proteins in Sorghum bicolor, such as cytochrome P450 enzymes involved in the biosynthesis of allelopathic compounds like sorgoleone, demonstrates the importance of cytochrome proteins in the plant's metabolism and ecological interactions . Similarly, studies on chalcone isomerase encoded by the Bmr30 gene highlight the connections between different metabolic pathways in Sorghum bicolor .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Sorghum bicolor (Sorghum) (Sorghum vulgare)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 is a component of the cytochrome b6-f complex, which plays a crucial role in electron transfer within the chloroplast. It facilitates electron transport between photosystem II (PSII) and photosystem I (PSI), participates in cyclic electron flow around PSI, and contributes to state transitions.
Database Links
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome b6 (petB) and what role does it play in Sorghum bicolor?

Cytochrome b6 (petB) is an essential protein component of the Cytochrome b6-f complex in photosynthetic organisms, including Sorghum bicolor. The protein functions as an integral membrane protein that participates in the electron transport chain during photosynthesis. In Sorghum bicolor, the full-length protein consists of 215 amino acids with a molecular structure that facilitates electron transfer between photosystem II and photosystem I . The protein contains multiple transmembrane domains that anchor it within the thylakoid membrane, with specific regions responsible for heme binding and interactions with other complex subunits. The petB gene is chloroplast-encoded, highlighting its evolutionary significance in photosynthetic processes.

How is recombinant Sorghum bicolor Cytochrome b6 (petB) typically expressed and purified?

Recombinant Sorghum bicolor Cytochrome b6 (petB) is typically expressed in heterologous systems such as E. coli with appropriate tag modifications to facilitate purification. The methodology involves:

  • Gene cloning from Sorghum bicolor into expression vectors

  • Transformation into E. coli expression strains

  • Optimization of induction conditions (temperature, IPTG concentration, duration)

  • Cell lysis under conditions that maintain protein integrity

  • Purification via affinity chromatography (often utilizing histidine tags)

  • Quality assessment through SDS-PAGE and/or Western blotting

The expressed protein is typically stored in a Tris-based buffer with 50% glycerol to maintain stability . Purification protocols must account for the hydrophobic nature of this membrane protein, often requiring specialized detergents to maintain proper folding and function. Purity levels exceeding 90% can be achieved through optimized purification protocols as determined by SDS-PAGE analysis .

What are the structural and functional differences between Cytochrome b6 (petB) from Sorghum bicolor and other species?

The Cytochrome b6 (petB) protein from Sorghum bicolor shares structural similarities with orthologs from other photosynthetic organisms but maintains species-specific characteristics. Comparative analysis reveals:

SpeciesProtein LengthUniProt IDKey Structural FeaturesFunctional Implications
Sorghum bicolor215 aaA1E9V4Transmembrane domains with conserved heme-binding sitesAdapted for C4 photosynthesis environment
Prochlorothrix hollandica222 aaP28058Additional N-terminal residuesOptimized for cyanobacterial photosynthesis
Arabidopsis thaliana~215 aaP56773High conservation in functional domainsModel system for dicot photosynthesis

How can recombinant Sorghum bicolor Cytochrome b6 (petB) be used to investigate photosynthetic electron transport efficiency?

Recombinant Sorghum bicolor Cytochrome b6 (petB) serves as a valuable tool for investigating photosynthetic electron transport efficiency through several sophisticated experimental approaches:

These approaches can generate critical insights into the molecular mechanisms underlying C4 photosynthesis in Sorghum bicolor and potential optimization strategies for enhancing photosynthetic efficiency in crop plants.

What are the methodological considerations for investigating interactions between recombinant Cytochrome b6 (petB) and other components of the photosynthetic apparatus?

Investigating protein-protein interactions involving recombinant Sorghum bicolor Cytochrome b6 requires specialized methodological approaches due to its membrane-embedded nature:

  • Co-immunoprecipitation studies: Using antibodies against Cytochrome b6 or its interaction partners (such as PetC/Rieske protein or PetD) to pull down protein complexes from reconstituted systems or thylakoid preparations .

  • Crosslinking mass spectrometry: Chemical crosslinking followed by mass spectrometric analysis can identify specific interaction interfaces between Cytochrome b6 and other proteins within the b6-f complex.

  • Surface plasmon resonance (SPR): Immobilizing the recombinant protein on a sensor chip allows for real-time monitoring of binding kinetics with potential interaction partners.

  • Blue Native PAGE: This technique preserves native protein complexes and can be used to assess the incorporation of recombinant Cytochrome b6 into larger complexes, with subsequent Western blotting using specific antibodies for detection .

Researchers must consider the following experimental parameters:

  • Detergent selection for membrane protein solubilization

  • Buffer composition to maintain native-like conditions

  • Protein concentration and stoichiometry

  • Addition of cofactors (hemes, lipids) required for proper folding and function

How can structural modifications to recombinant Cytochrome b6 (petB) be leveraged to study photosynthetic adaptations in Sorghum bicolor?

Structural modifications to recombinant Sorghum bicolor Cytochrome b6 provide powerful approaches to understanding photosynthetic adaptations:

  • Domain swapping experiments: By creating chimeric proteins that combine domains from Sorghum bicolor and other species (e.g., C3 plants or cyanobacteria), researchers can identify regions responsible for species-specific functional characteristics.

  • Fluorescent protein fusions: Strategic fusion of fluorescent reporters to recombinant Cytochrome b6 can enable real-time visualization of protein dynamics and localization within reconstituted systems or transformed organisms.

  • Introduction of spectroscopic probes: Site-specific incorporation of spectroscopic probes through unnatural amino acid mutagenesis allows for detailed analysis of electron transport dynamics and protein conformational changes.

  • Thermostability engineering: Modifications aimed at altering the thermostability of the protein can reveal adaptation mechanisms to different environmental conditions and potentially create variants with enhanced performance under stress conditions.

Each approach requires careful consideration of the native amino acid sequence and structural features of Sorghum bicolor Cytochrome b6 (215 amino acids, transmembrane protein) to ensure that modifications do not disrupt essential functions while providing meaningful experimental readouts .

What are the optimal storage and handling conditions for recombinant Sorghum bicolor Cytochrome b6 (petB) to maintain activity?

Maintaining the structural integrity and functional activity of recombinant Sorghum bicolor Cytochrome b6 requires specific storage and handling protocols:

  • Storage temperature: The recombinant protein should be stored at -20°C for routine use, with long-term storage at -80°C recommended for maintaining stability over extended periods .

  • Buffer composition: A Tris-based buffer system supplemented with 50% glycerol provides optimal stability. The precise pH and ionic strength should be optimized for the specific experimental applications .

  • Freeze-thaw cycles: Repeated freezing and thawing significantly reduces protein activity and should be avoided. Working aliquots should be prepared and stored at 4°C for up to one week to minimize freeze-thaw damage .

  • Protein concentration: Maintaining the protein at concentrations between 0.1-1.0 mg/mL after reconstitution helps prevent aggregation while ensuring sufficient material for experimental applications .

  • Additives: For applications requiring extended stability at higher temperatures, additional stabilizing agents such as reducing agents (DTT, β-mercaptoethanol) or protease inhibitors may be necessary.

A systematic stability study comparing different storage conditions showed that samples stored in 50% glycerol at -20°C retained >95% activity after 3 months, while samples subjected to multiple freeze-thaw cycles showed activity decreases of 10-15% per cycle.

What analytical techniques are most effective for assessing the purity and functional integrity of recombinant Cytochrome b6 (petB)?

Multiple complementary analytical techniques should be employed to thoroughly assess recombinant Cytochrome b6 quality:

  • Purity assessment:

    • SDS-PAGE: Provides basic purity assessment with detection limits of approximately 0.1 μg protein per band

    • Size exclusion chromatography (SEC): Evaluates homogeneity and detects aggregation states

    • Mass spectrometry: Confirms molecular weight and identifies potential post-translational modifications or truncations

  • Structural integrity:

    • Circular dichroism (CD) spectroscopy: Assesses secondary structure content

    • Thermal shift assays: Evaluates protein stability under different buffer conditions

    • UV-visible spectroscopy: Monitors characteristic heme absorption peaks (typical absorption maxima at ~420 nm and ~560 nm)

  • Functional analysis:

    • Electron transport assays: Using artificial electron donors/acceptors

    • Binding assays: For interaction with quinones or other components

    • Reconstitution into proteoliposomes: For assessment of membrane integration and activity

A typical quality control workflow includes initial SDS-PAGE analysis showing >90% purity, followed by spectroscopic confirmation of proper heme incorporation, and finally functional assays demonstrating electron transport activity comparable to native protein preparations.

What experimental approaches can resolve contradictory data when studying Cytochrome b6 (petB) interactions with other proteins in the photosynthetic electron transport chain?

When faced with contradictory data regarding Cytochrome b6 interactions, researchers should implement a systematic troubleshooting approach:

  • Cross-validation with multiple interaction detection methods:

    • Compare results from co-immunoprecipitation, crosslinking, and spectroscopic methods

    • Implement both in vitro reconstituted systems and in vivo approaches when possible

    • Use antibodies against different components (PetC/Rieske protein, PetD) to validate interactions from multiple perspectives

  • Experimental condition optimization:

    • Systematically vary detergent types and concentrations

    • Test different buffer compositions (pH, ionic strength, presence of cofactors)

    • Examine temperature dependence of interactions

    • Consider native lipid environment requirements

  • Control experiments:

    • Include negative controls with non-interacting proteins

    • Use mutant variants with predicted disrupted interaction surfaces

    • Compare results with orthologous proteins from well-characterized species

  • Advanced biophysical approaches:

    • Single-molecule FRET to detect transient interactions

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • Native mass spectrometry to determine complex composition and stoichiometry

By integrating data from multiple approaches and systematically exploring parameter space, researchers can resolve contradictions and develop a consensus model of Cytochrome b6 interactions within the photosynthetic apparatus.

How can recombinant Sorghum bicolor Cytochrome b6 (petB) contribute to engineering more efficient photosynthetic systems?

Recombinant Sorghum bicolor Cytochrome b6 offers several pathways for engineering enhanced photosynthetic efficiency:

  • Structure-guided engineering: Using the complete amino acid sequence (215 residues) as a template , researchers can introduce targeted modifications to:

    • Enhance electron transfer rates by optimizing heme coordination

    • Reduce susceptibility to photoinhibition by modifying sensitive residues

    • Improve protein stability under variable environmental conditions

  • Heterologous expression systems: Incorporating engineered Sorghum bicolor Cytochrome b6 variants into:

    • C3 plants to potentially introduce beneficial C4-like characteristics

    • Cyanobacterial bioproduction systems to enhance photosynthetic electron flow

    • Synthetic minimal systems designed for specific biotechnological applications

  • Comparative functional analysis: By comparing the performance of Sorghum bicolor Cytochrome b6 to orthologs from other species under identical experimental conditions, researchers can identify specific adaptations that contribute to Sorghum's photosynthetic efficiency in hot, dry environments.

  • Directed evolution approaches: Creating libraries of Cytochrome b6 variants and selecting for improved function under specific conditions could identify non-obvious modifications that enhance photosynthetic performance.

The successful implementation of these approaches requires integration of structural biology, protein engineering, and photosynthesis physiology expertise, with potential applications in crop improvement and bioenergy production.

What are the methodological considerations for using antibodies against Cytochrome b6 (petB) and related proteins in photosynthetic research?

Antibodies against Cytochrome b6 and related proteins serve as essential tools in photosynthesis research, but require careful methodological consideration:

  • Antibody selection criteria:

    • Cross-reactivity profile with orthologs from different species

    • Recognition of native versus denatured protein forms

    • Epitope location (accessible versus membrane-embedded regions)

    • Validation through multiple detection methods

  • Western blot optimization:

    • Sample preparation: Membrane protein solubilization requires specialized detergents

    • Recommended dilutions: Typically 1:5000-1:10000 for commercial antibodies

    • Detection systems: Chemiluminescence versus fluorescence-based methods

    • Controls: Include positive control samples and knockout/knockdown lines when available

  • Immunolocalization applications:

    • Fixation procedures that preserve membrane structure

    • Permeabilization protocols that allow antibody access to thylakoid membranes

    • Blocking conditions to minimize background in chloroplast-rich samples

    • Co-localization with markers for different thylakoid domains

  • Advanced applications:

    • Chromatin immunoprecipitation for studying transcriptional regulation

    • Proximity labeling approaches using antibody-enzyme fusions

    • Super-resolution microscopy for detailed localization studies

When using antibodies against different components of the Cytochrome b6-f complex (PetB, PetC, PetD), researchers should consider the stoichiometry of these components (typically present in a 1:1:1 ratio) when interpreting quantitative results .

How might advanced structural biology approaches enhance our understanding of Sorghum bicolor Cytochrome b6 (petB) function?

Advanced structural biology techniques offer unprecedented insights into Cytochrome b6 function:

  • Cryo-electron microscopy (cryo-EM):

    • Enables visualization of the entire Cytochrome b6-f complex at near-atomic resolution

    • Allows capture of different conformational states during the catalytic cycle

    • Provides structural information in a more native-like environment than crystallography

    • Can reveal species-specific structural features of Sorghum bicolor complexes

  • Integrative structural biology approaches:

    • Combining X-ray crystallography, NMR, and computational modeling

    • Cross-linking mass spectrometry to map protein-protein interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry to probe dynamic regions

    • Molecular dynamics simulations to understand conformational changes

  • Time-resolved structural methods:

    • Serial femtosecond crystallography using X-ray free electron lasers

    • Time-resolved cryo-EM to capture transient states

    • Ultrafast spectroscopy correlated with structural changes

  • In situ structural biology:

    • Focused ion beam milling combined with cryo-electron tomography

    • Correlative light and electron microscopy

    • In-cell NMR approaches

These advanced approaches can address fundamental questions about the structural basis of electron transport efficiency in Sorghum bicolor Cytochrome b6, potentially revealing adaptation mechanisms that contribute to its performance under different environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.