Recombinant Sorghum bicolor Cytochrome c biogenesis protein ccsA (ccsA)

Shipped with Ice Packs
In Stock

Description

Functional Role

CcsA is essential for cytochrome c biogenesis in System II pathways, facilitating heme delivery and covalent attachment to apocytochrome c . Key functional insights include:

  • Heme Ligase Activity: Forms a complex with CcsB to catalyze heme insertion into cytochrome c .

  • Membrane Localization: Predicted to localize to the thylakoid membrane in chloroplasts, critical for photosynthetic electron transport .

  • Evolutionary Conservation: Homologs exist in cyanobacteria, algae, and plants, highlighting conserved functional mechanisms .

3.1. Cytochrome c Assembly Studies

Recombinant ccsA enables functional dissection of System II cytochrome c biogenesis. In E. coli, co-expression of ccsA and ccsB restores cytochrome c4 assembly in system I-deficient strains .

3.3. Biotechnological Production

Commercial vendors (Creative Biomart, Anagnostics) produce recombinant ccsA for antibody development, enzymatic assays, and structural studies . Specifications include:

VendorCatalog No.PurityPrice
Creative BiomartRFL34322SF>90%$1,674 (50 µg)
AnagnosticsCSB-CF373996FJS>85%$1,674 (50 µg)

Key Research Findings

  • Functional Redundancy: Recombinant ccsA replaces the eight-gene System I complex in E. coli, demonstrating its sufficiency for heme ligation .

  • Transport Compatibility: Orthologs of ccsA transport diverse cyanogenic glucosides, suggesting functional versatility .

  • Structural Flexibility: Truncated variants (e.g., Δ1–50) retain activity, enabling soluble expression for crystallography .

Future Directions

  • CRISPR-Based Knockout Models: To elucidate ccsA’s role in S. bicolor photosynthesis and stress responses.

  • Structural Biology: Cryo-EM studies to resolve heme-binding dynamics .

  • Agricultural Engineering: Enhancing cytochrome c efficiency in bioenergy crops .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
ccsA; Cytochrome c biogenesis protein CcsA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-321
Protein Length
full length protein
Species
Sorghum bicolor (Sorghum) (Sorghum vulgare)
Target Names
ccsA
Target Protein Sequence
MLFATLEHILTHISFSTISIVITIHLITLLVRELRGLRDSSEKGMIATFFSITGFLVSRW VSSGHFPLSNLYESLIFLSWTLYILHTIPKIQNSKNDLSTITTPSTILTQGFATSGLLTE MHQSTILVPALQSQWLMMHVSMMLLSYATLLCGSLLSAALLIIRFRNSFDFFSLKKNVFL KTFFFSEIEYLYAKRSALKNTSFPVFPNYYKYQLTERLDSWSYRVISLGFTLLTVGILCG AVWANEAWGSYWNWDPKETWAFITWTIFAIYLHSRTNPNWKGTNSALVASIGFLIIWICY FGINLLGIGLHSYGSFTLPSK
Uniprot No.

Target Background

Function
This protein is essential for the biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f) during the heme attachment step.
Database Links
Protein Families
CcmF/CycK/Ccl1/NrfE/CcsA family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Sorghum bicolor cytochrome c biogenesis protein CcsA and what is its function?

Cytochrome c biogenesis protein CcsA in Sorghum bicolor is a membrane-bound protein involved in the system II pathway of cytochrome c maturation. It functions primarily in heme delivery and attachment to apocytochrome c. The CcsA protein typically forms a complex with CcsB (sometimes as a fused CcsBA protein) that carries out the critical functions of heme delivery and periplasmic cytochrome c-heme ligation .

In the cytochrome c biogenesis process, CcsA plays several key roles:

  • Facilitates the transport of heme across membranes

  • Participates in the stereochemical attachment of heme to the CXXCH motif of apocytochrome c

  • Contributes to the proper folding and maturation of cytochrome c

How is cytochrome c biogenesis organized in different systems?

Three distinct pathways for cytochrome c biogenesis have been identified across different organisms:

SystemOrganismsKey ComponentsCharacteristics
System IMost bacteria (e.g., E. coli)CcmA-H proteinsUses holo-CcmE as a heme chaperone; can use endogenous heme at low levels
System IICyanobacteria, some bacteria, chloroplastsCcsA, CcsB, DsbD, CcsXNo covalent heme intermediate identified; requires higher heme levels
System IIIMitochondria of fungi, animals, some protistsHCCS (holocytochrome c synthase)Simpler system with different recognition requirements

The search results highlight that "the CcsB and CcsA protein complex carries out the heme delivery function and periplasmic cytochrome c-heme ligation" . Additionally, "system I can use endogenous heme at much lower levels than system II" and "while system I encodes a covalently bound heme chaperone (holo-CcmE), no covalent intermediate has been found in system II" .

What are the optimal methods for expressing and purifying recombinant Sorghum bicolor CcsA protein?

Based on the search results and established research protocols for membrane proteins, the following methods are recommended for expression and purification of recombinant Sorghum bicolor CcsA:

Expression Systems:

  • E. coli is the most commonly used host for initial expression studies

  • Baculovirus-insect cell systems may provide better yields for full-length membrane proteins

  • Yeast expression systems (P. pastoris, S. cerevisiae) can offer proper folding for eukaryotic proteins

Purification Strategy:

  • Membrane Fraction Isolation:

    • Cell lysis by sonication or French press

    • Ultracentrifugation to isolate membrane fractions (typically 100,000 × g for 1 hour)

    • Solubilization using appropriate detergents (e.g., DDM, LDAO, or Triton X-100)

  • Affinity Chromatography:

    • Utilize His-tag for IMAC purification

    • Buffer optimization is critical (typically Tris/PBS-based buffer, pH 8.0 with 6% Trehalose)

  • Size Exclusion Chromatography:

    • For further purification and assessment of protein quality

    • HPLC SEC can be used to verify proper folding and complex formation

Storage Considerations:

  • Store at -20°C/-80°C upon receipt

  • Aliquot to avoid repeated freeze-thaw cycles

  • For working aliquots, store at 4°C for up to one week

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol is recommended for long-term storage

How can researchers effectively study CcsA function in vitro?

In vitro reconstitution of cytochrome c biogenesis systems has been challenging but is now possible with purified components. Based on studies with similar systems, researchers can:

  • Reconstitution Assay Setup:

    • Purify recombinant CcsA (alone or as CcsBA complex)

    • Use apocytochrome c and CXXCH-containing peptides as substrates

    • Provide heme (either co-purified or exogenously added)

    • Maintain reducing conditions with DTT or other reducing agents

    • Monitor heme attachment spectroscopically and by SDS-PAGE with heme staining

  • Spectroscopic Analysis:

    • Use UV-visible spectroscopy to monitor heme attachment

    • The covalent attachment of heme to cytochrome c shows characteristic absorption peaks:

      • Reduced b-type heme: peak at 560 nm

      • Reduced c-type (covalently attached) heme: peak at 550 nm

  • Functional Assays:

    • Time course experiments to measure enzyme kinetics

    • SDS-PAGE with heme staining to confirm covalent heme attachment

    • Size exclusion chromatography to assess product release and folding

Research Example:
In a study with bacterial CcsBA, "within 1–3 hr, the wt CcsBA shows two peaks of reduced heme, one at 560 nm and a 550 nm peak that is characteristic of covalent heme attached in c-type cytochromes" and "CcsBA in vitro synthesized cyt c is released and elutes at the same position as purified cyt c" .

How does the structure-function relationship of plant CcsA compare to bacterial counterparts?

Plant CcsA proteins, including that from Sorghum bicolor, share functional similarities with bacterial counterparts but have important differences that reflect their evolutionary adaptation to different cellular environments.

Key Structural Domains:

  • Tryptophan-rich motifs are critical for heme binding and transfer in bacterial systems

  • Transmembrane helices create a channel for heme transport

  • WWD domain (conserved tryptophan-rich sequence) is important for heme binding

Functional Comparisons:
Research on bacterial systems has shown that "changes of the single amino acids W119A, G120A, W123A, W125I and D126A or of the spacing within the motif by deleting V124 (ΔV124) inhibited the covalent heme incorporation" . Similar tryptophan-rich motifs likely play important roles in plant CcsA function.

The strongest mutant phenotype was observed when six residues of the tryptophan-rich motif were changed, resulting in no residual activity. This evidence supports "the functional importance of the tryptophan-rich motif for heme transfer" .

System II vs. System I Comparison:
In vitro reconstitution studies have revealed that "system I can use endogenous heme at much lower levels than system II" and "while system I encodes a covalently bound heme chaperone (holo-CcmE), no covalent intermediate has been found in system II" . This functional difference suggests that plant CcsA (part of System II) may have evolved different mechanisms for heme handling compared to System I proteins.

What methods are effective for analyzing CcsA-mediated heme delivery pathways?

Investigating heme delivery pathways mediated by CcsA requires a combination of biochemical, biophysical, and genetic approaches:

  • Site-Directed Mutagenesis:

    • Target conserved residues in putative heme-binding sites

    • Create variants with altered spacing within key motifs

    • Assess the impact of mutations on heme attachment efficiency

  • Protein-Protein Interaction Studies:

    • Crosslinking experiments to capture transient interactions

    • Co-immunoprecipitation to identify protein partners

    • Fluorescence resonance energy transfer (FRET) to monitor protein proximity

  • Heme Tracking Methods:

    • Use of labeled heme analogs

    • Time-resolved spectroscopy to follow heme transfer steps

    • Stopped-flow kinetic analysis of heme transfer reactions

Experimental Design Example:
A systematic study of bacterial cytochrome c biogenesis employed "a systematic mutational analysis of this motif. Changes of the non-conserved T121 and W122 to A resulted in wild-type CcmC activity. Changes of the single amino acids W119A, G120A, W123A, W125I and D126A or of the spacing within the motif by deleting V124 (ΔV124) inhibited the covalent heme incorporation into CcmE" . Similar approaches can be adapted for studying Sorghum bicolor CcsA.

How do environmental factors affect CcsA expression and function in Sorghum bicolor?

Environmental factors, particularly nitrogen availability, can significantly influence gene expression and protein function in Sorghum bicolor:

Nitrogen Form Effects:
Research on Sorghum bicolor has demonstrated that different nitrogen forms (ammonical, nitrate, and combined forms) affect plant performance differently. While this research was not specifically about CcsA, it shows that "S. bicolor performed better under the ammonical N form and combined N form (ammonical+nitrate)" . These findings suggest that nitrogen form could potentially influence the expression of genes involved in energy metabolism, including cytochrome biosynthesis.

Stress Response:
Under oxidative stress conditions, gene expression patterns can change significantly. In a study on cisplatin-induced oxidative stress, dietary inclusion of sorghum leaf sheath dye provided protection against oxidative damage by preserving antioxidant capacity . This suggests that stress conditions may influence the regulation of energy metabolism pathways that involve cytochrome c.

Experimental Approaches:

  • RT-qPCR analysis to quantify CcsA transcript levels under different conditions

  • Proteomics to measure CcsA protein abundance

  • RNA-seq to identify co-regulated genes under various environmental conditions

  • Use of the Sorghum bicolor transcriptome atlas to identify tissue-specific expression patterns

How can CcsA research contribute to improving Sorghum bicolor as a crop?

Research on cytochrome c biogenesis proteins like CcsA has potential applications for crop improvement:

Energy Metabolism Enhancement:
Understanding the role of CcsA in cytochrome c biogenesis could provide insights into energy metabolism efficiency. Since cytochrome c is a critical component of the electron transport chain, optimizing its biogenesis may improve energy conversion efficiency and potentially enhance drought tolerance or other stress responses.

Genetic Engineering Targets:
CcsA and related genes could serve as targets for genetic modification to improve plant performance. For example, researchers working on perennial Sorghum bicolor × S. propinquum hybrids could benefit from understanding how energy metabolism proteins like CcsA contribute to overwintering capacity and perenniality traits.

Improved Nitrogen Use Efficiency:
Research has shown that "modern hybrids had greater NIE (nitrogen internal efficiency) compared with those from the 1960s" . Understanding how energy metabolism proteins like CcsA respond to different nitrogen forms could contribute to developing varieties with improved nitrogen use efficiency.

What are the emerging technologies for studying plant cytochrome c biogenesis systems?

Several cutting-edge technologies are advancing our understanding of plant cytochrome c biogenesis:

  • CRISPR-Cas9 Gene Editing:

    • Precise modification of CcsA and related genes

    • Creation of knockout and knockin variants to study function

    • Development of tagged versions for in vivo localization and interaction studies

  • Cryo-Electron Microscopy:

    • Determination of membrane protein structures at near-atomic resolution

    • Visualization of CcsA-CcsB complexes and their interactions with substrates

    • Insights into the conformational changes during heme transport

  • Single-Molecule Techniques:

    • Real-time monitoring of heme attachment reactions

    • Visualization of protein dynamics during catalysis

    • Quantification of reaction intermediates

  • Systems Biology Approaches:

    • Integration of transcriptomics, proteomics, and metabolomics data

    • Network analysis to identify regulatory connections

    • Machine learning to predict protein function and interactions

Research Opportunity:
Whole-genome resequencing studies of Sorghum bicolor have generated "a total of 567,046,841 SNPs, 91,825,474 indels, 1,532,171 SVs, and 4,973,961 CNVs" . This genetic variation data represents an opportunity to investigate natural variation in CcsA and related genes across diverse Sorghum accessions.

How can in vitro reconstitution systems advance our understanding of CcsA function?

Recent breakthroughs in the in vitro reconstitution of cytochrome c biogenesis systems provide powerful tools for studying CcsA function:

Key Methodological Advances:
The first successful in vitro reconstitution of cytochrome c biogenesis using purified components has been reported . This approach allows researchers to:

  • Study substrate specificity using synthetic peptides and apocytochrome c

  • Investigate the role of specific amino acids through mutagenesis

  • Compare different biogenesis systems under controlled conditions

  • Develop inhibitors of cytochrome c biogenesis as research tools

Comparative Analysis Example:
In vitro reconstitution studies revealed dramatic differences between mitochondrial and bacterial systems: "Peptide analogs reveal very different recognition requirements between HCCS and CcsBA. For HCCS, a minimal 16-mer peptide is required, comprised of CXXCH and adjacent alpha helix 1, yet neither thiol is critical for recognition. For bacterial CcsBA, both thiols and histidine are required, but not alpha helix 1" .

Potential Applications:
These in vitro systems could be adapted to study plant CcsA proteins, enabling:

  • Biochemical characterization of Sorghum bicolor CcsA

  • Development of high-throughput assays for screening CcsA variants

  • Identification of molecules that modulate CcsA activity

What are the most promising research directions for Sorghum bicolor CcsA studies?

Based on the current state of research, several promising directions emerge:

What methodological challenges remain in studying Sorghum bicolor CcsA?

Despite recent advances, several challenges remain in the study of plant CcsA proteins:

  • Membrane Protein Expression:

    • Obtaining sufficient quantities of properly folded protein

    • Development of plant-specific expression systems

    • Optimization of detergent conditions for purification

  • Complex Formation:

    • Understanding the assembly of CcsA-CcsB complexes in plants

    • Reconstitution of the complete System II machinery

    • Identification of plant-specific auxiliary factors

  • In Vivo Analysis:

    • Development of tools for studying CcsA function in intact plants

    • Creation of conditional mutants to avoid lethal phenotypes

    • Technologies for visualizing CcsA localization and dynamics

  • High-Throughput Analysis:

    • Development of scalable assays for CcsA function

    • Methods for rapid screening of variants

    • Systems for testing hypotheses in planta

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.