Recombinant Sorghum bicolor NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Sorghum bicolor (Sorghum) (Sorghum vulgare)
Target Names
ndhC
Target Protein Sequence
MFLLHEYDIFWTFLIIASLIPILVFWISGLLAPVSEGPEKLSSYESGIEPMGGAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEAFIFVLILVVGLVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, the enzyme's primary electron acceptor is believed to be plastoquinone. NDH couples this redox reaction to proton translocation, conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the NAD(P)H-quinone oxidoreductase complex function in chloroplasts?

The NAD(P)H-quinone oxidoreductase complex in chloroplasts functions in parallel to cyclic and chlororespiratory electron flow pathways. This enzyme catalyzes the two-electron transfer from NAD(P)H to quinones (particularly plastoquinone) in the plastoglobules of chloroplasts. This process contributes to:

  • Reduction of the plastoquinone reservoir

  • Maintenance of redox balance in the chloroplast

  • Alternative electron transport pathways

  • Contribution to cyclic electron flow around photosystem I

How can enzyme activity of recombinant NAD(P)H-quinone oxidoreductase be measured?

NAD(P)H-quinone oxidoreductase activity can be measured through several established methodologies:

Spectrophotometric Assay Method:

  • Monitor the absorbance decrease at 340 nm, which corresponds to NAD(P)H oxidation

  • Typical reaction mixture: 50 μM quinone substrate, 500 μM NAD(P)H, and 0.1-10 μg enzyme in buffer (20 mM Tris-HCl pH 8, 100 mM NaCl, with 5% DMSO)

  • Controls should be performed in the absence of enzyme

  • Reactions are typically initiated by addition of enzyme and NAD(P)H to the quinone substrate

For specific substrates like menadione, researchers can measure the decay of NADH at A340nm using 50 μg lysate protein in the presence of the substrate and FAD as a coenzyme. The reaction kinetics can be represented by K decay values and half-life calculations .

What expression systems are most effective for producing recombinant Sorghum bicolor NAD(P)H-quinone oxidoreductase?

Multiple expression systems have been successfully employed for the production of recombinant NAD(P)H-quinone oxidoreductase, each with specific advantages:

Expression SystemAdvantagesConsiderationsTag Options
E. coliHigh yield, cost-effective, rapid productionMay lack post-translational modificationsN-terminal 10xHis-tag common
YeastEukaryotic post-translational processingLonger production time than E. coliVarious tag options available
BaculovirusHigh-level expression of complex proteinsMore complex setup, higher costCompatible with multiple tags
Mammalian cellsNative-like folding and modificationsMost expensive, lower yieldsVarious tag options available

For Sorghum bicolor NAD(P)H-quinone oxidoreductase specifically, in vitro E. coli expression systems have been successfully utilized to produce the recombinant protein with an N-terminal 10xHis-tag . For specialized applications such as those requiring biotinylation, in vivo biotinylation in E. coli using AviTag-BirA technology has been employed .

What is known about the structural characteristics of NAD(P)H-quinone oxidoreductase enzymes?

NAD(P)H-quinone oxidoreductases typically exhibit a bi-modular architecture with distinct functional domains:

  • NAD(P)H-binding groove - responsible for cofactor binding

  • Substrate-binding pocket - accommodates various quinone substrates

Crystal structure studies of related NAD(P)H-quinone oxidoreductases (such as the one from Phytophthora capsici) reveal that these enzymes often form oligomeric structures. The PcQOR-NADPH complex, for example, shows that each asymmetric unit contains two molecules stabilized by intermolecular interactions, while gel filtration and ultracentrifugation analyses demonstrate tetrameric function in solution .

The active site architecture varies among homologues, indicating differences in substrate specificities. In the NAD(P)H-quinone oxidoreductase from Phytophthora capsici, computational simulation combined with site-directed mutagenesis and enzymatic activity assays identified a potential quinone-binding channel. The catalytic mechanism involves redistribution of the quinone substrate by specific amino acid residues (including arginine, glutamine, tyrosine, cysteine, and threonine) and the NADPH nicotinamide ring .

How does NAD(P)H-quinone oxidoreductase in chloroplasts differ from mitochondrial counterparts?

NAD(P)H-quinone oxidoreductases in chloroplasts and mitochondria share functional similarities but have important distinctions:

CharacteristicChloroplastic NAD(P)H-quinone oxidoreductaseMitochondrial Type II NAD(P)H Dehydrogenases
Evolutionary originCyanobacterial originMultiple evolutionary origins
Primary functionReduction of plastoquinoneReduction of ubiquinone
Electron acceptorPlastoquinoneUbiquinone
LocalizationPlastoglobules in chloroplastsInner mitochondrial membrane
Role in metabolismContributes to cyclic electron flow, plastochromanol-8 accumulationAlternative electron input to respiratory chain
Sensitivity to inhibitorsDifferent inhibitor profileRotenone-insensitive

Research in Arabidopsis thaliana has identified seven type II NAD(P)H dehydrogenase homologs from three subfamilies (NDAs, NDBs, and NDC1), but only NDC1 appears to be of cyanobacterial origin. While initially all were thought to localize in mitochondria, subsequent studies have shown that NDC1 can be imported into both mitochondria and chloroplasts .

How can recombinant Sorghum bicolor NAD(P)H-quinone oxidoreductase be utilized in plant transformation studies?

Recombinant NAD(P)H-quinone oxidoreductase can serve as a marker or reporter gene in plant transformation studies. When working with Sorghum bicolor specifically, researchers have developed efficient transformation methods that can be utilized for expressing recombinant proteins:

  • Morphogene-assisted transformation (MAT): This approach has significantly improved transformation efficiency in sorghum, including recalcitrant varieties. For example, the transformation efficiency of sweet sorghum Ramada increased from 0.09% to 1.2% using this method .

  • Altruistic MAT: This modified approach allows simultaneous infection with multiple Agrobacterium strains, one containing a morphogene construct and another containing the gene of interest. This method has been successfully used to generate transgenic sorghum plants with various reporter genes .

A comparison of transformation efficiencies in different sorghum genotypes using these methods is shown below:

GenotypeTraditional EfficiencyMAT EfficiencyTime Reduction
RTx430Standard baseline9.4%18-21 weeks → 10-12 weeks
SC187Not previously reported as transformable2.0%-
BTx642Not previously reported as transformable0.9%-
BTx623Low efficiency0.1%-
Ramada0.09%1.2%-

These transformation methods could be applied to express recombinant NAD(P)H-quinone oxidoreductase for functional studies in planta .

What are the potential applications of NAD(P)H-quinone oxidoreductase in cancer research?

NAD(P)H-quinone oxidoreductases have significant implications for cancer research, though most studies have focused on mammalian NQO1 rather than plant homologs. The key applications include:

  • Activation of quinone-based chemotherapeutics: NAD(P)H-quinone oxidoreductases activate quinone-based treatments in chemotherapy. Variants like the human NQO1 R139W show altered activity and have been linked to mitomycin C resistance in colon cancer cells .

  • Protection of tumor suppressors: NQO1 protects tumor suppressors like p53, p33ING1b, and p73 from proteasomal degradation .

  • Cancer cell growth inhibition: Research on sorghum extracts rich in 3-deoxyanthocyanins (3-DXA) has shown that these compounds possess both NAD(P)H:quinone oxidoreductase (NQO) inducer activity and antiproliferative effects against HT-29 human colon cancer cells. Methoxylated 3-DXA are particularly effective:

    • Crude black sorghum extract with high levels of methoxylated 3-DXA induced NQO activity 3.0 times at 50 μg/mL

    • Methoxylated 3-DXA showed strong antiproliferative activity (IC50 < 1.5−53 μM)

    • Dimethoxylated 3-DXA were more potent than monomethoxylated analogues

These findings suggest potential for developing sorghum-based compounds that target NAD(P)H-quinone oxidoreductase pathways for cancer prevention or treatment.

How do environmental stressors affect NAD(P)H-quinone oxidoreductase expression and activity in Sorghum bicolor?

Environmental stressors can significantly modulate NAD(P)H-quinone oxidoreductase expression and activity in plants. In Sorghum bicolor specifically, proteomic studies have shown differential regulation of various metabolic enzymes in response to biotic stresses:

A label-free quantitative proteomics study on three genotypes of S. bicolor with differential resistance to the insect pest Chilo partellus (spotted stem borer) revealed changes in the systemic protein complement, including oxidoreductases. The resistant varieties (ICSV700, IS2205) showed different protein expression patterns compared to the susceptible variety (Swarna) .

Similarly, studies in other systems have shown that oxidative stress affects NAD(P)H-quinone oxidoreductases. For example, in human cells, hyperoxia (80% O2) has been shown to affect NQO1 activity. The enzyme helps protect cells from oxidative injury by decreasing reactive oxygen species (ROS) .

While specific data on environmental effects on sorghum NAD(P)H-quinone oxidoreductase subunit 3 is limited, the established role of related enzymes in redox homeostasis suggests similar regulatory mechanisms may exist in sorghum under various stressors.

What are the key differences in substrate specificity between NAD(P)H-quinone oxidoreductases from different organisms?

NAD(P)H-quinone oxidoreductases from different organisms exhibit significant variations in substrate specificity, which are determined by structural differences in their active sites:

  • Substrate size accommodation: Some NAD(P)H-quinone oxidoreductases preferentially reduce large substrates. For example, the enzyme from Pseudomonas syringae pv. tomato DC3000 (PtoQOR) has weak 1,4-benzoquinone catalytic activity but strong reduction activity towards large substrates such as 9,10-phenanthrenequinone .

  • Active site architecture: The Phytophthora capsici QOR (PcQOR) enzyme exhibits a wider active site that can accommodate larger quinone substrates. The putative substrate-binding site shows structural differences compared to E. coli and Thermus thermophilus HB8 homologs .

  • Methoxylation effects: In studies of sorghum 3-deoxyanthocyanins (3-DXA), methoxylation significantly affects enzyme interactions. Nonmethoxylated 3-DXA were effective against cancer cell growth but did not induce NQO activity, while methoxylated 3-DXA had both strong antiproliferative activity and NQO inducer activity .

  • Complementary substrate specificity: NAD(P)H quinone oxidoreductases from the same organism often have complementary substrate specificity profiles, allowing the organism to process a wider range of quinone substrates .

These differences in substrate specificity have significant implications for the physiological roles of these enzymes and their potential biotechnological applications.

What are the optimal storage conditions for recombinant Sorghum bicolor NAD(P)H-quinone oxidoreductase?

Based on manufacturer recommendations and experimental protocols, the optimal storage conditions for recombinant Sorghum bicolor NAD(P)H-quinone oxidoreductase are:

  • Temperature: Store at -20°C or -80°C upon receipt. For extended storage, -80°C is preferred.

  • Format: Available as liquid or lyophilized powder. Lyophilized format generally offers longer shelf life.

  • Buffer composition: Typically supplied in Tris-based buffer with 50% glycerol, pH optimized for protein stability.

  • Aliquoting: Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles.

  • Working aliquots: Store working aliquots at 4°C for up to one week.

  • Shelf life:

    • Liquid form: approximately 6 months at -20°C/-80°C

    • Lyophilized form: approximately 12 months at -20°C/-80°C

It's important to note that shelf life depends on multiple factors including storage state, buffer ingredients, storage temperature, and the inherent stability of the protein itself .

What quality control methods should be implemented when working with recombinant NAD(P)H-quinone oxidoreductase?

To ensure the quality and functionality of recombinant NAD(P)H-quinone oxidoreductase, the following quality control methods should be implemented:

  • Purity assessment: SDS-PAGE analysis to confirm protein purity (>85% purity is typically acceptable for research applications).

  • Activity assays: Spectrophotometric assays measuring NAD(P)H oxidation at 340 nm in the presence of appropriate quinone substrates.

  • Stability testing: Regular testing of aliquots to ensure enzyme activity is maintained over time and storage conditions.

  • Tag verification: If the protein contains affinity tags (such as His-tag), confirmation of tag integrity and accessibility using appropriate detection methods.

  • Mass spectrometry: For precise confirmation of protein identity and post-translational modifications.

  • Endotoxin testing: Particularly important for proteins produced in bacterial systems if they will be used in cell culture applications.

  • Functional assays: Testing the protein in its intended application to ensure it performs as expected.

These quality control measures ensure that experimental results using the recombinant protein are reliable and reproducible .

What are the emerging techniques for studying NAD(P)H-quinone oxidoreductase structure-function relationships?

Several cutting-edge techniques are advancing our understanding of NAD(P)H-quinone oxidoreductase structure-function relationships:

  • Cryo-electron microscopy (cryo-EM): This technique is increasingly being used to determine high-resolution structures of membrane-associated proteins and complexes, which could provide new insights into chloroplastic NAD(P)H-quinone oxidoreductases in their native membrane environment.

  • Computational simulations and molecular dynamics: Studies have successfully used computational simulation combined with site-directed mutagenesis to identify substrate-binding channels and propose catalytic mechanisms for NAD(P)H-quinone oxidoreductases .

  • Genome-wide association studies (GWAS): Applied to sorghum genetics, GWAS has been used to identify genetic factors associated with various traits. Similar approaches could be used to identify genetic variations affecting NAD(P)H-quinone oxidoreductase function and regulation .

  • Label-free quantitative proteomics: This approach has been used to study protein expression in sorghum under different conditions, providing insights into the regulation of various enzymes including oxidoreductases .

  • CRISPR/Cas9 gene editing: Morphogene-assisted transformation combined with CRISPR/Cas9 technology has been successfully applied in sorghum, offering powerful tools for functional studies of NAD(P)H-quinone oxidoreductase genes .

These emerging techniques offer promising avenues for advancing our understanding of NAD(P)H-quinone oxidoreductase structure, function, and regulation in Sorghum bicolor.

How might comparative studies between plant and bacterial NAD(P)H-quinone oxidoreductases inform biotechnological applications?

Comparative studies between plant and bacterial NAD(P)H-quinone oxidoreductases could yield valuable insights with significant biotechnological implications:

  • Enzyme engineering: Understanding structural differences between bacterial and plant enzymes could guide protein engineering efforts to create enzymes with enhanced stability, altered substrate specificity, or improved catalytic efficiency.

  • Bioremediation applications: Bacterial NAD(P)H-quinone oxidoreductases have been implicated in the detoxification of synthetic compounds. The ability to reduce quinones helps organisms like Phytophthora capsici detoxify harmful chemicals encountered during invasion . Comparative studies could lead to engineered enzymes for environmental remediation.

  • Agricultural applications: Insights from bacterial systems could inform strategies to enhance plant stress resistance. For example, the detoxification capabilities of these enzymes might be harnessed to improve crop tolerance to environmental toxins or herbicides.

  • Metabolic engineering: Understanding the differential regulation and substrate preferences of these enzymes across kingdoms could inform metabolic engineering efforts to produce high-value quinone-based compounds or modify existing metabolic pathways.

  • Therapeutic applications: Comparative studies could reveal conserved features essential for function versus species-specific adaptations, potentially informing the development of selective inhibitors for pathogen-specific enzymes while sparing host enzymes.

By elucidating the evolutionary adaptations that have shaped these enzymes across different kingdoms, researchers can identify key structural and functional elements that could be exploited for various biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.