Recombinant Sorghum bicolor NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Sorghum bicolor NAD(P)H-Quinone Oxidoreductase Subunit 4L, Chloroplastic

Recombinant Sorghum bicolor NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic (UniProt: A1E9X6) is a functional component of the chloroplast NADH dehydrogenase-like (NDH) complex. This protein plays a critical role in electron transport and proton translocation within the photosynthetic electron transfer chain. The recombinant form is expressed in E. coli and includes an N-terminal His tag for purification .

Key Identifiers

ParameterValue
Gene NamendhE
SynonymsNAD(P)H dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
EC Number1.6.5.-
Molecular Weight (Theoretical)11.2 kDa (Sorghum bicolor) ; 11.199 kDa (Hordeum vulgare)
AA SequenceMMFEHVLFLSVYLFSIGIYGLITSRNMVRALICLELILNSINLNLVTFSDLFDSRQLKGD IFAIFVIALAAAEAAIGLSILSSIHRNRKSTRINQSNFLNN

Protein Structure and Subunit Role

Subunit 4L is part of the NDH complex, which mediates cyclic electron flow (CEF) and chlororespiration. The NDH complex in plants contains 29+ subunits, including:

  • Subunit 4L: Involved in proton translocation and redox reactions .

  • Subunit F: Large subunit (87.6 kDa) with transmembrane domains critical for quinone binding .

  • Subunit H: 44.6 kDa subunit implicated in stabilizing the complex and interacting with photosystem I (PSI) .

Comparison of NDH Subunits

SubunitOrganismMolecular Weight (kDa)Key Function
4LSorghum bicolor11.2Proton translocation; redox coupling
FHordeum vulgare87.6Quinone binding; transmembrane domain
HHordeum vulgare44.6Complex stabilization; PSI interaction
6Hordeum vulgare19.6Structural support
KHordeum vulgare27.6Regulatory interactions

Expression and Purification

  • Expression System: E. coli .

  • Tag: N-terminal His tag for affinity chromatography .

  • Purity: >90% as determined by SDS-PAGE .

  • Form: Lyophilized powder stored in Tris/PBS buffer with 6% trehalose and 50% glycerol .

Key Research Findings

  1. Proton Translocation: The NDH complex couples electron transfer to proton pumping, critical for ATP synthesis .

  2. Photosynthetic Adaptation: Subunit 4L’s expression is often linked to stress responses and non-photochemical quenching in plants .

References

  1. Creative BioMart. (2025). Recombinant Sorghum bicolor NAD(P)H-quinone oxidoreductase subunit 4L.

  2. AgriSera. (2018). Anti-NdhH antibody.

  3. EMDB. (2020). Chloroplast NDH complex structure (EMD-31307).

  4. Afigen. (n.d.). ELISA Recombinant Sorghum bicolor NAD(P)H-quinone oxidoreductase subunit 4L.

  5. Anagnostics. (n.d.). ELISA Recombinant Sorghum bicolor NAD(P)H-quinone oxidoreductase subunit 4L.

  6. ChemicalBook. (n.d.). Recombinant Ipomoea purpurea NAD(P)H-quinone oxidoreductase subunit 4L.

  7. CBM15. (n.d.). ELISA Recombinant Sorghum bicolor NAD(P)H-quinone oxidoreductase subunit 4L.

  8. MyBioSource. (2014). NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Sorghum bicolor (Sorghum) (Sorghum vulgare)
Target Names
ndhE
Target Protein Sequence
MMFEHVLFLSVYLFSIGIYGLITSRNMVRALICLELILNSINLNLVTFSDLFDSRQLKGD IFAIFVIALAAAEAAIGLSILSSIHRNRKSTRINQSNFLNN
Uniprot No.

Target Background

Function
NDH is a protein that shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially in a chloroplast respiratory chain. In this species, the immediate electron acceptor for the enzyme is thought to be plastoquinone. This process couples the redox reaction to proton translocation, thereby conserving the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is known about the structure of NAD(P)H-quinone oxidoreductases in plants?

NAD(P)H-quinone oxidoreductases typically exhibit a bi-modular architecture with distinct functional domains. Based on structural studies of related oxidoreductases, these enzymes generally contain a NADPH-binding groove and a substrate-binding pocket in each subunit . The active site architecture determines substrate specificity, with variations among homologous structures indicating differences in the range of compounds they can process. Quinone oxidoreductases often function as oligomers in solution, with tetrameric or dimeric arrangements being common . The binding of NADPH typically occurs in a groove between two domains, and this binding induces conformational changes that facilitate subsequent substrate interactions and electron transfer.

What expression systems are most effective for producing recombinant Sorghum bicolor NAD(P)H-quinone oxidoreductase?

Several expression systems have proven effective for producing oxidoreductases for research purposes:

Expression SystemAdvantagesLimitationsBest For
Yeast (e.g., S. cerevisiae)Post-translational modifications, eukaryotic folding environmentLower yield than bacterial systemsFunctional studies, especially when native folding is critical
Bacterial (E. coli)High yield, simple culturing, cost-effectiveLimited post-translational modificationsStructural studies, enzymatic assays
Plant-based (e.g., N. benthamiana)Native-like folding and modificationsLabor-intensive, lower yieldsVerifying in planta activity, studying plant-specific modifications
Cell-free systemsRapid production, avoids toxicity issuesExpensive, limited scaleInitial screening, difficult-to-express proteins

For NAD(P)H-quinone oxidoreductases, heterologous expression in yeast systems and transient expression in Nicotiana benthamiana leaves have been successfully employed for related enzymes . When expressing the recombinant protein, it's critical to consider the inclusion of appropriate targeting sequences if studying the chloroplastic localization.

How can researchers determine the substrate specificity of NAD(P)H-quinone oxidoreductase from Sorghum bicolor?

Determining substrate specificity requires a multi-faceted approach:

  • Enzymatic activity assays: Testing the enzyme against multiple potential substrates of varying structures, particularly focusing on different quinone derivatives. Studies with related oxidoreductases have shown that some preferentially catalyze reactions with large substrates like 9,10-phenanthrenequinone rather than smaller compounds like 1,4-benzoquinone .

  • Structural analysis: Crystal structures in complex with NADPH and various substrates can provide insights into binding pocket architecture. Computational simulations combined with site-directed mutagenesis can identify residues involved in substrate recognition .

  • Spectroscopic methods: Monitor redox changes during enzymatic reactions using UV-visible spectroscopy to track substrate consumption and product formation.

  • Product analysis: Gas chromatography-mass spectroscopy (GC-MS) is particularly effective for identifying and quantifying reaction products, as demonstrated in studies of other oxidoreductases .

What environmental factors affect the catalytic efficiency of NAD(P)H-quinone oxidoreductases?

NAD(P)H-quinone oxidoreductases show significant sensitivity to environmental conditions:

  • pH dependence: The enzyme activity often exhibits a bell-shaped pH profile, with optimal activity typically in the range of pH 6.5-8.0, reflecting the environment of the chloroplast stroma.

  • Temperature effects: As with most enzymes, activity increases with temperature up to an optimal point before declining due to thermal denaturation.

  • Oxidative conditions: The enzyme's performance may be compromised under highly oxidative conditions that can damage the protein structure.

  • Solvent environment: Studies of oxidoreductases from extremophiles indicate adaptation to non-aqueous environments, suggesting that the hydrophobicity of the microenvironment significantly impacts catalytic efficiency .

  • Ionic strength: Particularly for a chloroplastic enzyme, activity may be modulated by changes in ionic strength that reflect shifting conditions during light/dark transitions.

What techniques are most effective for studying the kinetics of recombinant NAD(P)H-quinone oxidoreductase?

Several complementary techniques can be employed to study enzyme kinetics effectively:

  • Spectrophotometric assays: Monitoring NADPH oxidation at 340 nm provides a continuous readout of enzyme activity. This approach allows determination of Michaelis-Menten parameters (Km, Vmax, kcat) for both NADPH and quinone substrates.

  • Stopped-flow spectroscopy: For examining rapid reaction kinetics, particularly when investigating the electron transfer steps.

  • Oxygen consumption measurements: Using oxygen electrodes to monitor reactions that involve oxygen consumption or production.

  • Pre-steady-state kinetics: Employing rapid mixing techniques to identify intermediates in the catalytic cycle.

  • Influence of mediators: Testing activity in the presence of electron mediators such as ABTS or DL-DOPA, which has been shown to affect oxidation reactions catalyzed by sorghum oxidoreductases .

The choice of method should be guided by the specific research question, with consideration given to the stability of substrates and products under the assay conditions.

How can researchers confirm the chloroplastic localization of NAD(P)H-quinone oxidoreductase in Sorghum bicolor?

Confirming chloroplastic localization requires multiple complementary approaches:

  • Subcellular fractionation: Isolation of intact chloroplasts followed by western blotting can demonstrate the presence of the protein in chloroplastic fractions.

  • Immunolocalization: Using specific antibodies against the NAD(P)H-quinone oxidoreductase subunit 4L for immunogold labeling and electron microscopy or fluorescence microscopy with confocal imaging.

  • Fluorescent protein fusions: Creating fusions with fluorescent proteins (e.g., GFP) and expressing them in plant cells to visualize localization. This approach has been used successfully with other chloroplastic proteins .

  • Proteomics analysis: Mass spectrometry-based identification of the protein in purified chloroplast fractions.

  • Bioinformatic prediction: Analysis of the protein sequence for chloroplast transit peptides using tools like ChloroP or TargetP can provide preliminary evidence of localization.

For definitive confirmation, combining at least two independent approaches is recommended.

What strategies can be used to investigate the role of NAD(P)H-quinone oxidoreductase in plant stress responses?

Multiple strategies can elucidate the role of this enzyme in stress responses:

  • Gene silencing approaches: RNA interference (RNAi) or CRISPR-Cas9-mediated knockout/knockdown to suppress gene expression, followed by phenotypic and biochemical analysis under various stress conditions .

  • Overexpression studies: Generating transgenic plants overexpressing the NAD(P)H-quinone oxidoreductase to assess whether this confers enhanced stress tolerance.

  • Expression analysis: Quantitative RT-PCR to measure changes in gene expression under different stress conditions (drought, salinity, oxidative stress, etc.).

  • Metabolomic profiling: Comparing metabolite profiles between wild-type and modified plants to identify pathways affected by altered enzyme activity.

  • Enzymatic activity measurements: Comparing enzyme activity in plants exposed to different stressors, similar to studies showing increased oxidoreductase activity in sorghum root exudates when exposed to phenanthrene .

  • In vitro substrate studies: Testing enzyme activity against stress-related compounds or metabolites that accumulate during stress responses.

What purification strategies yield the highest activity for recombinant NAD(P)H-quinone oxidoreductase?

Purification of active recombinant enzyme requires careful consideration of protein stability:

  • Affinity chromatography: Incorporation of affinity tags (His-tag, GST) facilitates single-step purification while often preserving activity. For chloroplastic proteins, positioning the tag to avoid interfering with transit peptide cleavage is crucial.

  • Ion exchange chromatography: Separation based on the protein's charge properties, often effective as a secondary purification step.

  • Size exclusion chromatography: Useful for separating the active oligomeric form from aggregates or monomers, as quinone oxidoreductases often function as tetramers or dimers in solution .

  • Buffer optimization: Including stabilizing agents such as glycerol (10-20%), reducing agents (DTT or β-mercaptoethanol), and appropriate salt concentrations to maintain protein stability.

  • Temperature considerations: Performing purification steps at 4°C to minimize proteolytic degradation and maintain enzyme conformation.

The optimal purification strategy should be determined empirically, as the specific requirements for maintaining activity of the Sorghum bicolor NAD(P)H-quinone oxidoreductase may differ from related enzymes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.