Recombinant Sorghum bicolor Obtusifoliol 14-alpha demethylase (CYP51)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
CYP51; Obtusifoliol 14-alpha demethylase; CYPLI; Cytochrome P450 51; Cytochrome P450-LIA1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-492
Protein Length
full length protein
Species
Sorghum bicolor (Sorghum) (Sorghum vulgare)
Target Names
CYP51
Target Protein Sequence
MDLADIPQQQRLMAGLALVVATVIFLKLLLSFRSGGGKKRLPPTIPGAPVVGGLVKFMRG PIPMIREQYAALGSVFTVPIITRRITFLIGPEVSAHFFKGNEAEMSQQEVYRFNVPTFGP GVVFDVDYSVRQEQFRFFTEALRANKLRSYVDQMVAEAEEYFSKWGESGTVDLKYELEHL IILTASRCLLGREVREKLFDDVSALFHDLDNGIQPISVLFPYLPIPAHKRRDKARARLAE IFATIIKSRKASGQSEEDMLQCFIDSKYKNGRPTTEGEVTGLLIAALFAGQHTSSITSTW TGAYMLRFKQYFAEAVEEQKDVMKRHGDKIDHDILAEMDVLYRCIKEALRLHPPLIMLLR QSHSDFTVTTKEGKEYDIPKGHIVATSPSFANRLPHIYKNPDSYDPDRFGPGREEDKAAG AFSYISFGGGRHGCLGEPFAYLQIKAIWTHLLRNFEFELVSPFPENDWNAMVVGIKGEVM VNYKRRKLVVDN
Uniprot No.

Target Background

Function

Recombinant Sorghum bicolor Obtusifoliol 14-alpha demethylase (CYP51) catalyzes the 14-alpha demethylation of obtusifoliol to 4α-methyl-5α-ergosta-8,14,24(28)-trien-3β-ol.

Database Links

UniGene: Sbi.13512

Protein Families
Cytochrome P450 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Obtusifoliol 14-alpha demethylase (CYP51) from Sorghum bicolor?

Obtusifoliol 14-alpha demethylase from Sorghum bicolor is a cytochrome P450 enzyme that catalyzes an essential step in plant sterol biosynthesis. The enzyme is classified in the CYP51 family, which represents one of the most evolutionarily conserved cytochrome P450 families across biological kingdoms. This enzyme specifically catalyzes the oxidative removal of the 14α-methyl group from obtusifoliol to produce 4α-methyl-5α-ergosta-8,14,24(28)-trien-3β-ol, a critical intermediate in the phytosterol biosynthesis pathway . The protein is 492 amino acids in length, contains a single heme group, and is localized to the endoplasmic reticulum in plants .

What are the optimal conditions for heterologous expression of Sorghum bicolor CYP51 in E. coli?

For successful heterologous expression of functional Sorghum bicolor CYP51 in E. coli, researchers should consider the following optimized protocol:

  • Expression system: Use E. coli as the host organism with an appropriate expression vector containing a His-tag for purification .

  • Construct design: The full-length sequence (amino acids 1-492) should be cloned into the expression vector, maintaining the N-terminal membrane anchor for proper folding .

  • Culture conditions: After transformation, grow cultures at 37°C until reaching mid-log phase (OD600 of 0.6-0.8), then induce protein expression with an appropriate inducer (such as IPTG) .

  • Post-induction conditions: Lower the temperature to 25-30°C after induction to enhance proper protein folding and reduce inclusion body formation .

  • Expression verification: Monitor expression using SDS-PAGE analysis and confirm the presence of a band corresponding to the expected molecular weight of approximately 55-58 kDa .

The recombinant protein has been successfully expressed at high levels in E. coli, resulting in functional enzyme capable of binding substrate and producing the expected type I spectral changes when interacting with obtusifoliol .

What is the most efficient method for purifying recombinant Sorghum bicolor CYP51?

An efficient purification method for recombinant Sorghum bicolor CYP51 has been developed based on temperature-induced Triton X-114 phase partitioning, followed by affinity chromatography . The detailed procedure involves:

  • Cell lysis: Harvest cells and disrupt them using sonication or a French press in an appropriate buffer containing protease inhibitors.

  • Triton X-114 phase partitioning: Add Triton X-114 to the cell lysate (typically to a final concentration of 1-2%), incubate at 4°C to solubilize membrane proteins, then warm to 30°C to induce phase separation. The detergent-rich phase containing the membrane proteins (including CYP51) will separate from the aqueous phase .

  • Affinity chromatography: Apply the detergent-rich phase to a Ni-NTA or similar affinity column that binds the His-tagged protein, wash extensively, and elute with an imidazole gradient .

  • Quality assessment: Determine purity using SDS-PAGE (should be >90% pure) and assess specific heme content by measuring the A450/A420 ratio after CO binding .

This method has been shown to yield homogeneous protein suitable for enzymatic and spectroscopic studies, with functional properties preserved as evidenced by substrate binding and catalytic activity .

How can the enzymatic activity of purified recombinant Sorghum bicolor CYP51 be assessed?

Enzymatic activity of purified recombinant Sorghum bicolor CYP51 can be assessed through several complementary approaches:

  • Spectral binding assays: Monitor the type I spectral changes upon addition of obtusifoliol to the purified enzyme. This manifests as a decrease in absorbance at around 420 nm and an increase at approximately 390 nm, with saturation occurring at equimolar substrate/P450 concentrations .

  • Reconstituted enzyme assays: Reconstitute the purified enzyme with NADPH-cytochrome P450 reductase (preferably from Sorghum) in dilaurylphosphatidylcholine micelles or similar membrane mimetic systems. Incubate with obtusifoliol in the presence of NADPH and measure the formation of the demethylated product (4α-methyl-5α-ergosta-8,14,24(28)-trien-3β-ol) using techniques such as GC-MS .

  • Kinetic analysis: Determine enzyme kinetic parameters (Km, Vmax) by varying substrate concentrations and measuring initial reaction rates. For Sorghum bicolor CYP51 with obtusifoliol, a Vmax of approximately 5.5 nmol/min/nmol CYP51 has been reported .

  • Inhibition studies: Assess the interaction with inhibitors like azole fungicides (e.g., triadimenol and tebuconazole) by monitoring type II spectral changes (shift of the Soret band to longer wavelengths) and determining IC50 values through activity measurements in the reconstituted system .

ParameterValueReference
Vmax with obtusifoliol5.5 nmol/min/nmol CYP51
Substrate specificityHighly specific for obtusifoliol
Spectral changeType I with obtusifoliol
Inhibitor bindingType II with azole fungicides

Why does Sorghum bicolor CYP51 exhibit strict substrate specificity compared to fungal and mammalian orthologs?

The strict substrate specificity of Sorghum bicolor CYP51 appears to be primarily related to structural constraints within its active site that have been conserved throughout plant evolution. Research has identified that the presence of a 4β-methyl group in sterol molecules is a critical determinant of substrate compatibility . Plant CYP51 enzymes have evolved a precise active site architecture that accommodates obtusifoliol but excludes sterol substrates lacking this specific structural feature.

Comparative analysis of CYP51 orthologs from different kingdoms reveals:

  • Human CYP51: Can process multiple substrates with preference for dihydrolanosterol (Vmax=0.5 nmol/min/nmol CYP51) .

  • Candida albicans CYP51: Demonstrates broader substrate acceptance with preference for 24-methylene-24,25-dihydrolanosterol (Vmax=0.3 nmol/min/nmol CYP51) .

  • Sorghum bicolor CYP51: Shows exclusive activity toward obtusifoliol (Vmax=5.5 nmol/min/nmol CYP51) and is inactive toward lanosterol, 24-methylene-24,25-dihydrolanosterol, and dihydrolanosterol .

This strict substrate specificity has important implications for both the evolution of sterol biosynthesis pathways and the development of selective inhibitors targeting fungal CYP51 while sparing plant enzymes .

What is the detailed reaction mechanism of the 14α-demethylation catalyzed by Sorghum bicolor CYP51?

The 14α-demethylation reaction catalyzed by Sorghum bicolor CYP51 proceeds through a complex, multi-step oxidative process that removes the 14α-methyl group from obtusifoliol. The complete reaction is:

obtusifoliol + 3 reduced [NADPH-hemoprotein reductase] + 3 dioxygen → 4α-methyl-5α-ergosta-8,14,24(28)-trien-3β-ol + formate + 3 oxidized [NADPH-hemoprotein reductase] + 4 H2O + H+

The reaction mechanism involves:

  • Initial monooxygenation: The first step involves the hydroxylation of the 14α-methyl group, requiring one molecule of O2 and one equivalent of reducing power from NADPH via the cytochrome P450 reductase.

  • Second oxidation: The resulting 14α-hydroxymethyl intermediate undergoes a second hydroxylation to form a 14α-formyl intermediate.

  • Final oxidation and elimination: A third oxidation leads to the formation of a 14α-formate ester, which undergoes elimination to release formate and generate the 14,15-double bond in the sterol skeleton.

How do azole fungicides interact with Sorghum bicolor CYP51 compared to fungal CYP51?

Azole fungicides interact with both plant and fungal CYP51 enzymes by binding to the active site and coordinating with the heme iron, but with different affinities that have important implications for fungicide selectivity. Key findings include:

  • Binding mechanism: Azole fungicides (such as triadimenol and tebuconazole) induce type II spectral changes in Sorghum bicolor CYP51, indicating coordination between the nitrogen atom of the azole group and the heme iron, with saturation occurring at equimolar azole/P450 concentrations .

  • Relative affinities: Contrary to previous assumptions, purified Sorghum bicolor CYP51 shows only about threefold less sensitivity to azole fungicides compared to the fungal CYP51 from Ustilago maydis, based on IC50 values .

  • Structural basis: The relatively small difference in sensitivity suggests that the active site architecture of plant and fungal CYP51 enzymes may be more similar than previously thought, despite their different substrate preferences .

  • Implications: This moderate difference in sensitivity implies that the selectivity of azole fungicides in agricultural applications may rely on additional factors beyond direct enzyme inhibition, such as uptake, metabolism, or compensatory mechanisms .

This research challenges earlier assumptions about the high selectivity of azole fungicides for fungal over plant CYP51 enzymes and has implications for understanding fungicide mode of action and agricultural application strategies .

What are the key considerations when designing inhibition studies for Sorghum bicolor CYP51?

When designing inhibition studies for Sorghum bicolor CYP51, researchers should consider the following key methodological aspects:

  • Enzyme preparation: Use highly purified enzyme preparations with confirmed homogeneity by SDS-PAGE and specific heme content. This is critical for obtaining reproducible and meaningful inhibition data .

  • Spectral binding studies:

    • Titrate the purified enzyme with increasing concentrations of inhibitor

    • Monitor type II spectral changes (shift in the Soret band to longer wavelengths)

    • Determine binding constants (Ks) using appropriate curve-fitting methods

    • Compare with positive controls (known inhibitors) and negative controls

  • Activity assays:

    • Use reconstituted systems with purified Sorghum NADPH-cytochrome P450 reductase

    • Incorporate dilaurylphosphatidylcholine or similar lipids to form micelles

    • Test a range of inhibitor concentrations (typically 0.001-100 μM)

    • Maintain consistent substrate concentrations near Km

    • Calculate IC50 values and compare with fungal CYP51 inhibition under identical conditions

  • Controls and comparisons:

    • Always run parallel inhibition studies with fungal CYP51 (e.g., from Ustilago maydis) under identical conditions

    • Include substrate specificity controls to verify enzyme functionality

    • Consider multiple inhibitors from different structural classes to develop comprehensive structure-activity relationships

  • Data analysis:

    • Use appropriate kinetic models (competitive, non-competitive, mixed)

    • Consider cooperative binding effects if observed

    • Report both absolute IC50 values and relative inhibition compared to fungal enzymes

These considerations ensure that inhibition data are reliable and relevant for understanding the structural basis of inhibitor selectivity between plant and fungal CYP51 enzymes.

What factors should be considered when reconstituting Sorghum bicolor CYP51 activity in vitro?

Successful reconstitution of Sorghum bicolor CYP51 activity in vitro requires careful attention to several critical factors:

  • Redox partner selection: The choice of NADPH-cytochrome P450 reductase significantly impacts activity. Using the homologous Sorghum bicolor reductase is ideal, but other plant reductases can function effectively. The molar ratio of CYP51 to reductase should be optimized (typically 1:1 to 1:3) .

  • Membrane environment: CYP51 is a membrane-associated enzyme that requires a suitable lipid environment for optimal activity:

    • Dilaurylphosphatidylcholine (DLPC) micelles are commonly used at concentrations of 0.1-0.5 mg/ml

    • The lipid:protein ratio should be optimized for maximum activity

    • Alternative membrane mimetic systems (nanodiscs, liposomes) may provide improved stability for certain applications

  • Buffer composition:

    • pH optimization: typically pH 7.2-7.5

    • Ionic strength affects enzyme-reductase interactions

    • Inclusion of glycerol (10-20%) enhances stability

    • Divalent cations (Mg2+, Ca2+) at 1-5 mM may improve electron transfer

  • Substrate delivery: Obtusifoliol has limited aqueous solubility, so delivery methods are crucial:

    • Use of solvents (ethanol, DMSO) at <1% final concentration

    • Incorporation into lipid micelles

    • Cyclodextrin complexation for controlled release

  • Reaction conditions:

    • Temperature (typically 25-30°C)

    • NADPH regenerating system (glucose-6-phosphate/glucose-6-phosphate dehydrogenase)

    • Oxygen availability (ensure sufficient for complete reaction)

    • Reaction time optimized for linear phase of product formation

By systematically optimizing these parameters, researchers can achieve reconstituted activities that approach the native enzyme performance, with reported activities for Sorghum bicolor CYP51 with obtusifoliol reaching Vmax values of approximately 5.5 nmol/min/nmol CYP51 .

How can researchers troubleshoot low expression or activity issues with recombinant Sorghum bicolor CYP51?

When encountering low expression or activity issues with recombinant Sorghum bicolor CYP51, researchers should implement the following troubleshooting strategies:

  • Expression troubleshooting:

    • Codon optimization: Plant genes often contain codons that are rare in E. coli. Optimize the coding sequence for E. coli codon usage without altering the amino acid sequence.

    • Expression vector selection: Test different promoters (T7, tac) and vector backbones that may improve expression.

    • Host strain optimization: Evaluate specialized E. coli strains that provide additional tRNAs for rare codons or contain chaperones to assist protein folding.

    • Growth conditions: Systematically vary induction temperature (15-30°C), inducer concentration, and post-induction time to optimize for soluble protein production.

    • N-terminal modifications: Consider using a truncated construct removing the membrane-anchor region while maintaining essential catalytic domains .

  • Protein quality assessment:

    • Spectral characteristics: Verify the CO-difference spectrum shows the characteristic peak at 450 nm rather than 420 nm, which would indicate properly folded protein with correctly incorporated heme.

    • Heme content quantification: Determine the heme:protein ratio, which should approach 1:1 for fully functional enzyme.

    • Substrate binding: Confirm type I spectral shifts with obtusifoliol to verify active site integrity .

  • Activity troubleshooting:

    • Redox partner compatibility: Test multiple sources of NADPH-cytochrome P450 reductase if the homologous Sorghum reductase is unavailable.

    • Lipid environment optimization: Systematically vary lipid composition and concentration in reconstitution assays.

    • Substrate quality: Ensure obtusifoliol purity and proper solubilization.

    • Product detection method: Optimize analytical methods (GC-MS conditions, extraction procedures) for detecting the 14α-demethylated product .

  • Storage and stability considerations:

    • Buffer optimization: Include glycerol (20-50%) and reducing agents to prevent oxidation during storage.

    • Temperature sensitivity: Store at -80°C in small aliquots to prevent freeze-thaw damage.

    • Reconstitution from lyophilized state: Follow recommended procedures for reconstituting lyophilized protein (0.1-1.0 mg/mL in deionized sterile water) .

By systematically addressing these factors, researchers can improve both the expression levels and catalytic activity of recombinant Sorghum bicolor CYP51.

How can structural comparative analysis between plant, fungal, and mammalian CYP51 inform the design of selective inhibitors?

Structural comparative analysis of CYP51 enzymes from different kingdoms offers valuable insights for designing selective inhibitors targeting fungal enzymes while minimizing effects on plant and mammalian orthologs. This approach involves several sophisticated strategies:

  • Active site architecture comparison: The strict substrate specificity of Sorghum bicolor CYP51 for obtusifoliol (versus the broader specificity of fungal and mammalian enzymes) indicates significant structural differences in the active site . These differences, particularly related to accommodation of the 4β-methyl group in plant sterols, can be exploited to design inhibitors that selectively target fungal CYP51.

  • Homology modeling and molecular dynamics: In the absence of crystal structures for all three kingdom representatives, homology models combined with molecular dynamics simulations can identify critical differences in:

    • Substrate binding channels

    • Heme environment accessibility

    • Key residues involved in azole coordination

    • Water networks that may influence inhibitor binding kinetics

  • Structure-activity relationship (SAR) studies: The observation that plant CYP51 shows only threefold less sensitivity to certain azole fungicides than fungal CYP51 suggests that current inhibitors may not be optimally exploiting structural differences. Systematic modification of azole scaffolds guided by structural insights could enhance selectivity.

  • Binding kinetics analysis: Beyond simple affinity measurements, detailed analysis of association and dissociation kinetics may reveal differences in inhibitor interactions that could be exploited for selective targeting.

  • Transition state analysis: Understanding differences in the catalytic mechanisms and transition states between plant and fungal enzymes could guide the development of transition state analogs with enhanced selectivity .

This research direction is particularly valuable for agricultural applications, where selective inhibition of fungal pathogens without affecting crop plants is essential for effective and environmentally responsible disease control .

What is the evolutionary significance of the different substrate specificities observed in CYP51 enzymes across kingdoms?

The distinct substrate specificities observed in CYP51 enzymes across biological kingdoms reveal fascinating aspects of evolutionary divergence and conservation in sterol biosynthesis pathways:

  • Evolutionary conservation of function: Despite divergence in substrate preferences, CYP51 enzymes across all kingdoms catalyze the same reaction—14α-demethylation of sterol precursors—highlighting the essential nature of this step in producing functional sterols. The absence of a 14α-methyl group is a universal feature of all known functional sterols across life forms .

  • Divergence in substrate recognition: The strict substrate specificity of Sorghum bicolor CYP51 for obtusifoliol compared to the broader specificity of fungal and mammalian enzymes reflects the divergence of sterol biosynthesis pathways during evolution . Plants evolved to use 4,4-dimethylsterols with a 4β-methyl group as CYP51 substrates, while fungi and mammals use 4,4,14-trimethylsterols.

  • Implications for ancient sterol pathway evolution:

    • The different substrate preferences suggest that the sterol biosynthesis pathway diverged early in evolution

    • Plant-specific modifications to the pathway likely occurred after the divergence from the fungal/animal lineage

    • The conservation of the CYP51 catalytic function across kingdoms suggests it was present in the last common ancestor of all eukaryotes

  • Functional consequences: The evolution of kingdom-specific substrate specificities may reflect adaptation to different membrane requirements or environmental pressures. The end products of these pathways—ergosterol in fungi, cholesterol in animals, and sitosterol/stigmasterol in plants—have distinct physical properties that may provide selective advantages in their respective cellular contexts .

  • Exceptions revealing evolutionary plasticity: The discovery that some plant CYP51 enzymes (e.g., from Solanum chacoense) can demethylate both obtusifoliol and lanosterol suggests evolutionary plasticity in substrate recognition that may represent intermediate stages in the specialization of these enzymes or adaptations to specific ecological niches.

Understanding these evolutionary patterns provides insights into the fundamental processes of protein specialization and may guide both protein engineering efforts and the development of targeted inhibitors .

How can recombinant Sorghum bicolor CYP51 be used in studying the regulation of plant sterol biosynthesis pathways?

Recombinant Sorghum bicolor CYP51 serves as a powerful tool for investigating the regulation of plant sterol biosynthesis pathways through several sophisticated experimental approaches:

  • Metabolic flux analysis: Using purified recombinant CYP51 in reconstituted systems allows researchers to measure precise reaction rates and identify potential rate-limiting steps in the sterol biosynthesis pathway. By systematically varying substrate concentrations, cofactor availability, and the presence of pathway intermediates, researchers can map the regulatory network controlling sterol production .

  • Feedback inhibition studies: Testing whether downstream sterol pathway products inhibit CYP51 activity can reveal regulatory mechanisms that maintain homeostasis in sterol biosynthesis. The purified recombinant enzyme allows for controlled experiments isolating direct effects on CYP51 from other cellular processes .

  • Post-translational modification analysis: Investigating how post-translational modifications (phosphorylation, glycosylation, etc.) affect CYP51 activity can uncover dynamic regulatory mechanisms. Recombinant protein expression systems can be modified to incorporate or mimic these modifications .

  • Protein-protein interaction studies: Identifying interaction partners of CYP51 may reveal additional regulatory mechanisms. The purified recombinant protein can be used in pull-down assays, surface plasmon resonance studies, or crosslinking experiments to identify binding partners .

  • Transcriptional regulation insights: Comparing the properties of recombinant CYP51 with the enzyme in plant tissues under various conditions can help decipher transcriptional regulation mechanisms. For example, the observation that obtusifoliol treatment induces CYP51 expression suggests a possible signaling role for this biosynthetic intermediate .

  • Sterol intermediate signaling: The discovery that obtusifoliol can induce expression of CYP51 in Solanum chacoense suggests these intermediates may function as bioactive signaling molecules . Purified recombinant CYP51 enables precise control of obtusifoliol conversion, allowing researchers to investigate this potential regulatory mechanism.

  • Comparative analysis across plant species: Comparing the biochemical properties of recombinant CYP51 from Sorghum bicolor with those from other plant species can reveal species-specific adaptations in sterol biosynthesis regulation, particularly in response to different environmental conditions or developmental stages .

These approaches collectively provide a comprehensive toolbox for dissecting the complex regulatory networks controlling plant sterol biosynthesis, with implications for understanding plant development, stress responses, and potential biotechnological applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.