Recombinant Sorghum bicolor Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Sorghum bicolor Photosystem I Assembly Protein Ycf4 (ycf4)

The protein "Recombinant Sorghum bicolor Photosystem I assembly protein Ycf4 (ycf4)" refers to the Ycf4 protein, which is involved in the assembly of Photosystem I (PSI) in Sorghum bicolor . Ycf4 is essential for PSI complex assembly in the green alga C. reinhardtii . It is a highly conserved protein among photosynthetic organisms .

Function in Photosystem I Assembly

Ycf4 functions as an assembly chaperone of Photosystem I (PSI) . The Ycf4 complex may act as a scaffold for PSI assembly by directly mediating the interactions between newly synthesized PSI polypeptides and assisting in the assembly of the PSI complex .

Ycf4 in Different Organisms

  • Chlamydomonas reinhardtii: In C. reinhardtii, Ycf4 is essential for PSI complex assembly .

  • Arabidopsis thaliana: In Arabidopsis thaliana, Ycf4 (also designated Pyg) is not essential but plays a regulatory role .

  • Cyanobacteria: A cyanobacterial mutant deficient in Ycf4 can still assemble the PSI complex, although at a reduced level .

  • Higher Plants (Tobacco): ycf4 knockout mutants in tobacco are capable of assembling sufficient amounts of PSI to allow for slow autotrophic growth. These mutants are severely affected in their photosynthetic performance and are extremely sensitive to light, but they can grow photoautotrophically under low-light conditions .

Experimental Methods and Analysis

MethodDescription
Tandem Affinity PurificationA two-step affinity column chromatography was performed in conjunction with tandem affinity purification (TAP)-tag technology to purify the Ycf4 complex. The TAP-tag consists of calmodulin binding peptide and Protein A domains separated by a tobacco etch virus protease cleavage site .
ImmunoblottingWhole-cell proteins were subjected to SDS-PAGE and polypeptides separated and analyzed by immunoblotting using anti-Ycf4 antibody to check the effect of the TAP-tag on Ycf4 stability .
Fluorescence Induction KineticsFluorescence induction kinetics of dark-adapted cells confirmed that the TAP-tag strain displays PSI activity .
Electron MicroscopyThe purified Ycf4 preparation was visualized by transmission electron microscopy and single-particle analysis to reveal the structure of the Ycf4-containing complex .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Sorghum bicolor (Sorghum) (Sorghum vulgare)
Target Names
ycf4
Target Protein Sequence
MNWRSEHIWIELLKGSRKRGNFFWACILFLGSLGFLAVGASSYLGKNMISLLPSQQILFF PQGVVMSFYGIAGLFISSYLWCTILWNVGSGYDRFDRKEGIVCIFRWGFPGIKRRIFLQF LVRDIQSIRIQVKEGLYPRRILYMEIRGQGVIPLTRTDEKFFTPREIEQKAAELAYFLGV PIEVF
Uniprot No.

Target Background

Function
Essential for the assembly of the photosystem I complex.
Database Links

KEGG: sbi:4549170

Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Ycf4 and what is its role in photosynthesis?

Ycf4 (hypothetical chloroplast open reading frame 4) is a thylakoid membrane protein essential for the assembly and accumulation of photosystem I (PSI) complex. This protein is firmly associated with the thylakoid membrane, presumably through transmembrane domains, and plays a crucial role in the light-dependent reactions of photosynthesis. Without Ycf4, photosynthesis would be inefficient, significantly affecting plant growth and development. The protein functions as part of a large complex that acts as a scaffold for PSI assembly, directly mediating interactions between newly synthesized PSI polypeptides and assisting in complex formation .

What is known about the structure and size of the Ycf4-containing complex?

The Ycf4-containing complex is exceptionally large, exceeding 1500 kD in size. Electron microscopy studies of purified preparations reveal particles measuring approximately 285 × 185 Å, which may represent several large oligomeric states. In Chlamydomonas reinhardtii, this complex contains not only Ycf4 but also the opsin-related protein COP2 and several PSI subunits (PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF). Through sucrose gradient ultracentrifugation and ion exchange column chromatography, researchers have demonstrated that almost all Ycf4 and COP2 in wild-type cells co-purify, indicating their intimate and exclusive association within the complex .

What are effective methods for isolating and purifying recombinant Ycf4 from Sorghum bicolor?

To effectively isolate and purify recombinant Ycf4 from Sorghum bicolor, researchers can employ tandem affinity purification (TAP) tag technology. This approach involves:

  • Generating a fusion construct with the TAP-tag (consisting of calmodulin binding peptide and Protein A domains separated by a tobacco etch virus protease cleavage site) at the C-terminus of Ycf4

  • Transforming Sorghum bicolor with this construct

  • Solubilizing thylakoid membranes using an appropriate detergent like n-dodecyl-β-D-maltoside (DDM)

  • Performing two-step affinity column chromatography:

    • First column: IgG agarose with overnight incubation at 4°C

    • Second column: Calmodulin affinity resin after tobacco etch virus protease cleavage

This methodology has been successful in Chlamydomonas reinhardtii and could be adapted for Sorghum bicolor, ensuring that approximately 90% of Ycf4 can be effectively adsorbed and purified .

How can I establish a knockout system for Ycf4 in Sorghum bicolor to study its function?

Establishing a knockout system for Ycf4 in Sorghum bicolor requires a targeted genome editing approach that considers the location of the ycf4 gene in the chloroplast genome. Based on methodologies used in other plants:

  • Design a chloroplast transformation vector with:

    • Left border flanking sequence: Sequence upstream of ycf4 (e.g., psaI gene region)

    • Right border flanking sequence: Sequence downstream of ycf4 (e.g., ycf10 region)

    • Selection marker cassette: Include genes like aadA (aminoglycoside 3'-adenyltransferase) for spectinomycin resistance

    • Reporter gene: GFP for visual confirmation

  • Deliver the construct via biolistic transformation using a particle gun with gold particles

  • Select transformants on medium containing appropriate antibiotics (e.g., 500 mg/L spectinomycin)

  • Conduct multiple rounds of selection to achieve homoplasmy (complete replacement of all wild-type chloroplast genomes)

  • Confirm knockout through PCR, Southern blotting, and protein analysis

  • Evaluate phenotypic changes, particularly in photosynthetic efficiency and autotrophic growth ability .

What expression systems are most suitable for producing recombinant Sorghum bicolor Ycf4 for structural studies?

For structural studies of Sorghum bicolor Ycf4, several expression systems can be considered, each with distinct advantages:

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, rapid growth, established protocolsMay lack proper folding for membrane proteins, no post-translational modificationsInitial protein characterization, antibody production
Yeast (e.g., Pichia pastoris)Eukaryotic post-translational modifications, capable of membrane protein expressionLower yield than E. coli, longer growth timeFunctional studies requiring proper folding
Insect cells (Baculovirus)Advanced eukaryotic system, good for complex proteinsTechnical complexity, costHigh-resolution structural studies
Plant-based (e.g., Nicotiana benthamiana)Native-like environment, appropriate post-translational modificationsLower yield, time-consumingIn planta function validation
Cell-free systemsRapid, avoids toxicity issuesExpensive, may have lower yieldDifficult-to-express proteins

For membrane proteins like Ycf4, systems that can properly incorporate the protein into membranes or membrane-mimetic environments are preferable. For high-resolution structural studies such as cryo-EM or X-ray crystallography, insect cell or yeast expression systems often provide the best compromise between yield and proper folding .

How does Ycf4 interact with other proteins in the PSI assembly pathway in Sorghum bicolor?

To characterize Ycf4 interactions in the PSI assembly pathway in Sorghum bicolor, researchers should implement a multi-faceted approach:

  • Co-immunoprecipitation (Co-IP) with antibodies against Ycf4 or TAP-tagged Ycf4, followed by mass spectrometry to identify interacting partners

  • Yeast two-hybrid screening or split-ubiquitin assays (for membrane proteins) to identify direct protein-protein interactions

  • Bimolecular fluorescence complementation (BiFC) to visualize interactions in vivo

  • Protein crosslinking followed by mass spectrometry to capture transient interactions

  • Blue native PAGE combined with western blotting to identify native protein complexes containing Ycf4

In Chlamydomonas reinhardtii, Ycf4 has been shown to interact with PSI subunits (PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF) and the opsin-related protein COP2. Pulse-chase protein labeling experiments revealed that the PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as a pigment-containing subcomplex, suggesting that Ycf4 acts early in the PSI assembly process .

How do environmental stresses affect Ycf4 expression and function in Sorghum bicolor?

To understand environmental stress effects on Ycf4 in Sorghum bicolor, researchers should consider that while Ycf4-specific stress responses haven't been directly characterized in Sorghum, related proteins show significant stress responsiveness:

Sorghum bicolor contains 48 homologous genes comprising 21 proline-rich proteins (PRPs) and 27 hybrid proline-rich proteins (HyPRPs), which show distinct expression patterns under various stresses. Though Ycf4 is not a PRP, studying stress response patterns in chloroplast proteins can provide insight into photosystem assembly under stress.

A comprehensive approach to study Ycf4 stress responses would include:

  • RT-qPCR analysis of ycf4 expression under different stresses (drought, salt, heat, cold)

  • Western blot analysis to measure protein abundance changes

  • Blue native PAGE to examine PSI assembly complex formation under stress

  • Photosynthetic parameter measurements (Fv/Fm, ETR, etc.) in wild-type versus ycf4 mutants under stress

  • Transcriptomic and proteomic analyses to identify co-expressed genes/proteins

In Sorghum, promoter analysis of stress-responsive genes has revealed regions rich with phosphorous-responsive (BIHD), ammonium-, sulfur-responsive (SURE), and iron starvation-responsive (IRO2) elements along with biotic, abiotic, and development-specific cis-elements. Similar analysis of the ycf4 promoter region could reveal potential stress-responsive regulatory mechanisms .

What bioinformatic tools are recommended for analyzing Ycf4 sequence conservation and predicting functional domains in Sorghum bicolor?

For comprehensive bioinformatic analysis of Sorghum bicolor Ycf4, utilize the following tools and methodologies:

  • Sequence Conservation Analysis:

    • Multiple Sequence Alignment: MUSCLE, CLUSTALW, or T-Coffee for aligning Ycf4 sequences across species

    • Conservation Visualization: Jalview or WebLogo to identify highly conserved regions

    • Phylogenetic Analysis: MEGA, PhyML, or MrBayes for evolutionary relationship inference

  • Structural Prediction:

    • Transmembrane Domain Prediction: TMHMM, Phobius, or TOPCONS

    • Secondary Structure Prediction: PSIPRED, JPred, or SOPMA

    • 3D Structure Modeling: I-TASSER, Phyre2, or AlphaFold2

    • Protein Disorder Prediction: PONDR or IUPred

  • Functional Domain Analysis:

    • Domain Recognition: InterProScan, Pfam, or SMART

    • Motif Identification: MEME Suite or MotifFinder

    • Protein-Protein Interaction Site Prediction: SPPIDER or PredUs

  • Comparative Genomics:

    • Synteny Analysis: SynMap (CoGe) or MCScanX to examine genomic context

    • Selection Analysis: PAML or HyPhy to detect evolutionary pressure on specific sites

Ycf4 belongs to the Pfam domain PF02392 and InterPro domain IPR003359, which can serve as starting points for functional annotation. The protein typically contains two transmembrane domains and is associated with the thylakoid membrane, features that should be confirmed in the Sorghum bicolor ortholog .

How can I optimize protein expression conditions for recombinant Sorghum bicolor Ycf4?

Optimizing expression of recombinant Sorghum bicolor Ycf4 requires systematic testing of multiple parameters. Implement this methodical approach:

  • Expression System Selection:

    • For membrane proteins like Ycf4, consider eukaryotic systems (yeast, insect cells) that better handle membrane protein folding

  • Construct Design Optimization:

    • Test multiple fusion tags (His, GST, MBP, SUMO) at both N- and C-termini

    • Include cleavage sites (TEV, PreScission) for tag removal

    • Consider codon optimization for the selected expression host

    • Design constructs with and without predicted transmembrane domains

  • Expression Condition Matrix Testing:

ParameterVariables to Test
Temperature15°C, 20°C, 25°C, 30°C
Induction Time3h, 6h, overnight, 24h, 48h
Inducer Concentration0.1, 0.5, 1.0 mM IPTG (for E. coli); various % methanol (for Pichia)
MediaLB, TB, 2xYT, autoinduction (for E. coli); various formulations for other systems
AdditivesGlycerol (5-10%), sorbitol, arginine, various detergents
  • Solubilization Screen:

    • Test multiple detergents (DDM, LDAO, OG, CHAPS, Fos-choline) at various concentrations

    • Try detergent mixtures or novel amphipols

    • Consider nanodiscs or liposomes for reconstitution

  • Purification Strategy:

    • Implement two-step affinity purification as demonstrated for Chlamydomonas Ycf4

    • Optimize buffer conditions (pH, salt concentration, glycerol percentage)

    • Include stabilizing additives (specific lipids, cofactors)

  • Quality Assessment:

    • Size-exclusion chromatography to evaluate monodispersity

    • Circular dichroism to assess secondary structure

    • Functional assays to confirm activity

Based on successful approaches with Chlamydomonas Ycf4, consider using DDM for solubilization and implementing the TAP-tag purification strategy, which has proven effective for isolating intact Ycf4 complexes .

What spectroscopic techniques are most informative for characterizing the Ycf4-PSI assembly intermediate?

For comprehensive characterization of the Ycf4-PSI assembly intermediate in Sorghum bicolor, employ these spectroscopic and analytical techniques:

  • Absorption Spectroscopy:

    • UV-Visible absorption spectroscopy (400-700 nm range) to identify chlorophyll and carotenoid signatures

    • Differential absorption spectroscopy to detect subtle changes in pigment organization during assembly

  • Fluorescence Techniques:

    • Steady-state fluorescence emission spectra at 77K to distinguish between PSI and PSII contributions

    • Time-resolved fluorescence to measure energy transfer kinetics

    • Fluorescence induction kinetics to assess PSI activity in vivo

  • Circular Dichroism (CD):

    • Far-UV CD to analyze protein secondary structure

    • Visible-range CD to examine pigment-protein interactions and complex formation

  • Electron Paramagnetic Resonance (EPR):

    • Low-temperature EPR to characterize iron-sulfur clusters during assembly

    • ENDOR or HYSCORE for detailed analysis of cofactor binding sites

  • Mass Spectrometry:

    • Native MS to determine complex stoichiometry

    • Hydrogen-deuterium exchange MS to identify protein interaction surfaces

    • Crosslinking MS to map spatial relationships between subunits

  • Electron Microscopy:

    • Negative stain EM for initial structural characterization

    • Cryo-EM for high-resolution structural analysis of assembly intermediates

  • Other Biophysical Techniques:

    • Analytical ultracentrifugation to determine complex size and shape

    • SAXS/SANS for solution structure determination

    • Surface plasmon resonance to measure binding kinetics

Research on Chlamydomonas Ycf4 has shown that the purified Ycf4-containing complex can be visualized by transmission electron microscopy, revealing structures measuring 285 × 185 Å. Additionally, pulse-chase protein labeling has demonstrated that PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as a pigment-containing subcomplex .

How can I distinguish between direct and indirect effects when studying Ycf4 knockouts in Sorghum bicolor?

Distinguishing direct from indirect effects in Ycf4 knockout studies requires a multi-faceted experimental design:

  • Generate Multiple Knockout Lines:

    • Complete gene removal (as in tobacco studies showing failure to grow autotrophically)

    • Partial gene deletion (as in tobacco studies where plants retained autotrophic growth)

    • Site-directed mutagenesis of key residues to create less severe phenotypes

    • Conditional knockouts using inducible systems

  • Implement Complementation Studies:

    • Reintroduce wild-type Ycf4 to confirm phenotype rescue

    • Test cross-species complementation with Ycf4 from other plants

    • Introduce chimeric or mutated versions to identify functional domains

  • Perform Time-Course Analyses:

    • Monitor changes in transcript, protein, and metabolite levels at various times after knockout induction

    • Early changes are more likely direct effects; later changes often represent secondary consequences

  • Apply Systems Biology Approaches:

    • Transcriptomics: RNA-Seq to identify altered gene expression patterns

    • Proteomics: Quantitative proteomics to detect protein abundance changes

    • Metabolomics: Profile metabolic changes resulting from knockout

    • Network analysis to identify primary versus secondary response nodes

  • Use Specific Assays for PSI Assembly:

    • In vitro reconstitution assays with isolated components

    • Pulse-chase labeling to track the fate of newly synthesized PSI components

    • Blue native PAGE to visualize assembly intermediates

Research in tobacco has shown that complete removal of YCF4 prevents autotrophic growth, while plants retaining 91 amino acids from the C-terminal region can still grow autotrophically. In-silico protein-protein interaction studies suggest that this C-terminal region interacts with other chloroplast proteins, potentially explaining the differential effects .

What are the most common pitfalls in interpreting protein-protein interaction data for Ycf4 complexes?

When interpreting protein-protein interaction data for Ycf4 complexes, researchers should be aware of these common pitfalls and their mitigation strategies:

PitfallDescriptionMitigation Strategy
Detergent-induced artifactsMembrane protein interactions can be disrupted or artificially created by detergentsUse multiple detergents; validate with complementary methods; consider crosslinking prior to solubilization
Transient interactionsBrief interactions may be missed in traditional pull-down assaysEmploy chemical crosslinking; use proximity labeling techniques (BioID, APEX); perform time-course analyses
Non-specific bindingCommon in affinity purification, leading to false positivesInclude appropriate controls (unrelated membrane proteins with similar tags); perform quantitative interaction proteomics with statistical filtering
Tag interferenceTags may disrupt native interactions or create artificial onesTest multiple tag positions and types; validate key interactions with untagged proteins using specific antibodies
Incomplete complex purificationLarge complexes like Ycf4-PSI assembly may partially dissociateOptimize solubilization and purification conditions; use gradient centrifugation to separate intact complexes
Cell type-specific interactionsInteractions may differ in bundle sheath vs. mesophyll cells in C4 plantsIsolate cell-specific chloroplasts; perform in situ localization studies
Developmental stage variationsInteractions may change during chloroplast developmentSample at multiple developmental stages; use inducible expression systems

In Chlamydomonas reinhardtii, the Ycf4 complex includes PSI subunits and COP2, but COP2 knockdown to 10% of wild-type levels only affected salt sensitivity of the Ycf4 complex without impacting PSI accumulation. This suggests careful interpretation is needed to distinguish between structural components and functional partners in the complex .

How should contradicting results between in vitro and in vivo studies of Ycf4 function be reconciled?

Reconciling contradictions between in vitro and in vivo studies of Ycf4 function requires a systematic approach to understand the source of discrepancies:

  • Identify Specific Contradictions:

    • Document exact parameters that differ between systems

    • Determine whether contradictions are qualitative (presence/absence of effect) or quantitative (degree of effect)

  • Evaluate Experimental Conditions:

    • In vitro simplification: Are key components missing in the in vitro system?

    • Physiological relevance: Do in vitro conditions (pH, ion concentrations, redox state) match the chloroplast environment?

    • Time scale differences: Are measurements taken at comparable time points relative to the assembly process?

  • Bridge the Gap with Intermediate Approaches:

    • Isolated chloroplast studies (semi-in vivo)

    • Reconstituted membrane systems with defined components

    • Cell-free expression systems with thylakoid membranes

  • Apply Advanced Techniques to Both Systems:

    • Single-molecule studies to detect rare or transient events

    • Real-time monitoring of assembly processes

    • Structural studies at multiple resolutions

  • Develop Quantitative Models:

    • Create mathematical models incorporating data from both approaches

    • Use models to predict conditions where contradictions might be resolved

    • Test model predictions experimentally

  • Consider System-Specific Factors:

    • Species differences: Tobacco studies show YCF4 essentiality depends on which protein regions are removed

    • C3 vs. C4 photosynthesis: Sorghum bicolor's C4 pathway may have unique requirements

The apparent contradiction in tobacco, where complete removal of YCF4 prevents autotrophic growth while partial removal allows it, was reconciled through in-silico protein-protein interaction studies showing that the C-terminal region (91 aa) interacts with other chloroplast proteins. Similarly, COP2's role in the Ycf4 complex in Chlamydomonas appeared contradictory until it was determined that while COP2 affects complex stability under salt stress, it is not essential for PSI assembly under normal conditions .

What emerging technologies hold the most promise for advancing our understanding of Ycf4's role in Sorghum bicolor?

Emerging technologies with the greatest potential to advance Ycf4 research in Sorghum bicolor include:

  • CRISPR-Based Technologies:

    • Prime editing for precise modification of chloroplast genes without double-strand breaks

    • CRISPR interference (CRISPRi) for tunable repression of ycf4 expression

    • CRISPR activation (CRISPRa) to enhance expression for gain-of-function studies

    • Base editing for introducing specific point mutations

  • Advanced Imaging Methods:

    • Cryo-electron tomography of intact chloroplasts to visualize Ycf4 complexes in their native environment

    • Super-resolution microscopy (PALM/STORM) to track Ycf4 localization and dynamics

    • Label-free imaging techniques (Raman microscopy) to avoid tag-induced artifacts

    • Correlative light and electron microscopy to connect function with structure

  • Proximity Labeling Proteomics:

    • TurboID or APEX2 fusions to map the Ycf4 interactome in vivo

    • Time-resolved proximity labeling to capture assembly intermediates

    • Spatially restricted labeling to differentiate bundle sheath vs. mesophyll interactions

  • Synthetic Biology Approaches:

    • Minimal PSI assembly systems reconstituted from purified components

    • Orthogonal translation systems to incorporate non-canonical amino acids for crosslinking

    • Designer chloroplasts with simplified or modified photosystems

  • Single-Cell Technologies:

    • Single-cell proteomics to examine cell-type-specific variations in Ycf4 complexes

    • Spatial transcriptomics to map expression patterns across leaf tissues

    • Cell-type-specific ribosome profiling to measure translation dynamics

  • Integrative Multi-Omics:

    • Combined transcriptome, proteome, and metabolome analysis of ycf4 mutants

    • Network modeling to predict system-wide effects of Ycf4 perturbation

    • Machine learning approaches to identify patterns in complex datasets

These technologies could help resolve key questions about Ycf4 function in the context of Sorghum's C4 photosynthesis, potentially revealing specialized roles in different chloroplast types within bundle sheath and mesophyll cells .

How can researchers effectively combine genetic and biochemical approaches to elucidate the complete assembly pathway of PSI in Sorghum bicolor?

An effective integrated approach to elucidate the PSI assembly pathway in Sorghum bicolor should combine:

  • Genetic Engineering Strategies:

    • CRISPR/Cas9 mutagenesis of ycf4 and related assembly factors

    • Generation of epitope-tagged lines for each PSI subunit

    • Creation of conditional expression systems for time-resolved assembly studies

    • Development of reporter lines with fluorescently tagged PSI components

    • Establishment of recombinant inbred lines (RILs) to map assembly QTLs

  • Biochemical Purification and Analysis:

    • Tandem affinity purification of Ycf4 complexes at different assembly stages

    • Gradient ultracentrifugation to separate assembly intermediates

    • Blue native PAGE combined with second-dimension SDS-PAGE

    • Pulse-chase labeling with 35S-methionine to track protein synthesis and assembly

    • Crosslinking mass spectrometry to map interaction interfaces

  • Structural Biology Approaches:

    • Cryo-EM of purified assembly intermediates

    • X-ray crystallography of stable subcomplexes

    • NMR studies of smaller domains and interactions

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

  • Functional Validation Methods:

    • In vitro reconstitution of PSI from purified components

    • Site-directed mutagenesis of key residues identified in structural studies

    • Complementation assays with mutated versions of assembly factors

    • Spectroscopic analysis of assembly intermediates

  • Integration with Systems Biology:

    • Temporal transcriptomics and proteomics during chloroplast development

    • Metabolic flux analysis to measure functional consequences of assembly defects

    • Mathematical modeling of assembly pathways based on experimental data

Research in Chlamydomonas has established that the Ycf4 complex contains newly synthesized and partially assembled PSI subunits, indicating it functions as a scaffold for assembly. This could be further explored in Sorghum bicolor using the established tandem affinity purification approach that successfully isolated the >1500 kD Ycf4 complex from Chlamydomonas .

What comparative genomics approaches would be most informative for understanding the evolution of Ycf4 function in C4 plants like Sorghum bicolor?

Comparative genomics approaches to understand Ycf4 evolution in C4 plants should include:

  • Phylogenomic Analysis Across Photosynthetic Lineages:

    • Sequence alignment and phylogenetic tree construction for Ycf4 across diverse photosynthetic organisms

    • Ancestral sequence reconstruction to identify critical evolutionary transitions

    • Selection analysis (dN/dS ratios) to detect sites under positive selection

    • Coevolution analysis between Ycf4 and PSI subunits

  • C3 vs. C4 Comparative Analysis:

    • Comparison of Ycf4 sequences across multiple independent C4 origins

    • Analysis of regulatory elements in C3 vs. C4 species

    • Examination of chloroplast genome structure and gene arrangement surrounding ycf4

    • Investigation of cell-type-specific expression patterns in C4 species

  • Synteny and Whole-Genome Context:

    • Analysis of gene order conservation in chloroplast genomes

    • Identification of co-transferred genes during endosymbiotic gene transfer events

    • Examination of nuclear genes encoding proteins that interact with Ycf4

  • Structural Bioinformatics:

    • Homology modeling of Ycf4 across diverse species

    • Conservation mapping onto predicted structures

    • Molecular dynamics simulations to compare functional dynamics

    • Protein-protein interaction interface prediction and comparison

  • Hybrid Approaches:

    • Experimental testing of Ycf4 orthologs from different species in Sorghum bicolor

    • Creation of chimeric Ycf4 proteins to identify functionally divergent domains

    • CRISPR-based replacement of Sorghum Ycf4 with versions from C3 plants

This comparative approach would be particularly valuable given the specialized chloroplast types in C4 plants like Sorghum bicolor. The recombinant inbred line (RIL) population of 161 F5 genotypes from S. bicolor × S. propinquum crosses could provide a powerful resource for mapping traits related to photosynthetic efficiency and PSI assembly across related genotypes with different photosynthetic characteristics .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.