Recombinant Sorghum bicolor Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

CP47 forms part of the PSII reaction center, anchoring chlorophyll molecules and enabling energy transfer during photosynthesis . Its structural domains include:

  • Transmembrane helices: Critical for embedding in thylakoid membranes.

  • Chlorophyll-binding motifs: Facilitate light absorption and electron transport .

Studies highlight its interaction with extrinsic oxygen-evolving enhancer proteins, stabilizing the water-splitting complex .

Research Findings in Drought Responses

Field and laboratory studies reveal CP47's role in drought tolerance:

Table 1: CP47 Expression Under Drought Conditions in Sorghum Genotypes

GenotypePostflowering Drought ResponseCP47 Protein Levels (vs. Control)
BTx642Maintains PSII activity and CP47 stability; associated with stay-green phenotypeNo significant decline
RTx430Shows reduced CP47 levels (25–50% of control); faster recovery post-droughtSignificant decline

Key insights:

  • BTx642 retains higher CP47 levels under drought, linked to reactive oxygen species (ROS) scavenging and glutathione S-transferase activity .

  • Constitutive upregulation of proline biosynthesis enzymes (P5CS2) in BTx642 enhances drought resilience .

Diagnostic Tools

  • ELISA Kits: Commercial kits (e.g., Anagnostics) utilize recombinant CP47 for antibody validation and photosynthetic studies .

  • Antibody Production: Polyclonal antibodies (e.g., Agrisera AS04 038) target CP47 for immunoblotting and PSII quantification .

Agricultural Research

  • Drought Tolerance Engineering: CP47 stability under stress informs breeding strategies for climate-resilient crops .

Future Research Directions

  • Mechanistic Studies: Elucidate CP47’s role in ROS management during drought.

  • CRISPR-Based Modifications: Enhance CP47 expression to improve crop yields under water-limited conditions .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize the development of the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Sorghum bicolor (Sorghum) (Sorghum vulgare)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSISGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQA VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSDGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRDKEGRELFVRRMP TFFETFPVVLVDEEGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGTFQKVGDPTTRRQAA
Uniprot No.

Target Background

Function
CP47, also known as Photosystem II chlorophyll apoprotein (psbB), is a crucial component of the core complex in photosystem II (PSII). It binds chlorophyll and plays a vital role in catalyzing the primary light-induced photochemical processes of PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H2O, generating O2 and a proton gradient, which is subsequently used for ATP formation.
Database Links
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbB gene and what protein does it encode in Sorghum bicolor?

The psbB gene in Sorghum bicolor encodes the CP47 chlorophyll apoprotein, which serves as an essential core antenna component of Photosystem II (PSII). CP47 functions primarily in light harvesting and energy transfer to the reaction center chlorophylls, playing a vital role in the initial stages of photosynthesis. The protein has been hypothesized to be involved in binding reaction center chlorophyll, though its exact role in this process is still being investigated . Research demonstrates that CP47 is absolutely essential for photosynthetic function, as interruption of the psbB gene results in complete loss of Photosystem II activity .

The CP47 protein contains multiple transmembrane domains and binds several chlorophyll molecules that facilitate light absorption and energy transfer. A notable structural feature includes five pairs of histidine residues spaced by 13 or 14 amino acids, located in hydrophobic regions of the protein, which are likely involved in chlorophyll binding . The protein's hydropathy pattern shows remarkable conservation across photosynthetic organisms, indicating that the general folding pattern of CP47 in the thylakoid membrane is similar across different species . This high degree of conservation reflects the fundamental importance of this protein to photosynthetic function across diverse organisms.

How does the structure of CP47 relate to its function in photosynthesis?

The structure of CP47 is intimately linked to its function in photosynthesis, particularly in light harvesting and energy transfer. CP47 contains multiple transmembrane helices that anchor the protein within the thylakoid membrane, positioning it optimally relative to other PSII components. The protein's histidine residues, located in hydrophobic regions, create binding sites for chlorophyll molecules, allowing precise spatial arrangement necessary for efficient energy transfer . This structural arrangement facilitates the capture of light energy and its directed transfer toward the reaction center of Photosystem II.

What methods are used to study psbB gene expression in Sorghum bicolor?

Studying psbB gene expression in Sorghum bicolor involves multiple complementary techniques that address different aspects of gene regulation. RNA blot hybridization (Northern blotting) can be used to analyze the accumulation of psbB transcripts under various conditions, providing insights into transcriptional regulation. This approach has been applied in studies of related genes, showing that transcription patterns can remain consistent even when protein synthesis is affected . Polysome association analysis through sucrose density gradient ultracentrifugation offers valuable information about translational efficiency, as demonstrated in studies where enhanced polysome loading of psbB transcripts was observed despite reduced protein synthesis .

In vivo pulse labeling of chloroplast proteins with radiolabeled amino acids provides direct measurement of protein synthesis rates, enabling researchers to quantify CP47 production under different conditions or in various mutant backgrounds . This technique revealed that in the fpb1 mutant, CP47 synthesis was reduced to approximately 50% compared to wild type, despite normal transcript levels and increased polysome association . Western blot analysis using specific antibodies against CP47 allows detection of the protein in various PSII assembly intermediates, as demonstrated using two-dimensional blue native/SDS-PAGE . This approach can reveal how mutations affect the incorporation of CP47 into higher-order PSII complexes. Real-time quantitative PCR provides another sensitive method for measuring transcript levels, allowing precise quantification of psbB expression changes in response to environmental conditions or developmental cues.

What is known about the regulation of CP47 synthesis and assembly in photosynthetic organisms?

Assembly factors play critical roles in facilitating CP47 synthesis and integration into Photosystem II. Proteins such as FPB1 synergistically cooperate with PAM68 to promote proper PSII assembly, with mutations in these factors leading to reduced CP47 accumulation and altered PSII assembly patterns . The predominant CP47-containing complexes in assembly factor mutants include PSII monomers and CP43-less PSII complexes, suggesting specific blockages in the assembly pathway . Interestingly, defects in PSII assembly due to mutations in auxiliary factors can have secondary effects on other photosynthetic complexes, as evidenced by moderately reduced synthesis of PSI subunits in fpb1 mutants . This indicates extensive crosstalk between the assembly pathways of different photosynthetic complexes, highlighting the integrated nature of the photosynthetic apparatus.

What approaches are most effective for expressing recombinant Sorghum bicolor CP47 protein in heterologous systems?

Expressing recombinant Sorghum bicolor CP47 protein presents significant challenges due to its complex membrane integration and chlorophyll-binding requirements. Based on experiences with similar photosynthetic proteins, several key considerations should guide expression system selection. Bacterial expression systems may require modification to support chlorophyll or chlorophyll-analog synthesis, as proper folding of CP47 likely depends on pigment binding. Alternatively, eukaryotic expression systems like yeast or insect cells might provide more appropriate cellular machinery for membrane protein expression. For plant-based expression, chloroplast transformation in model organisms like tobacco offers the advantage of native-like folding environment and appropriate co-factors.

Expression constructs should be designed with careful attention to potential impact on protein folding and function. When adding affinity tags for purification, C-terminal tags are often preferable to avoid interfering with N-terminal transit peptides or protein insertion into membranes. Codon optimization for the host organism can significantly improve expression yields, particularly for chloroplast genes that may have codon usage patterns distinct from nuclear genes. Temperature control during expression is critical, with lower temperatures (15-20°C) often improving membrane protein folding by slowing synthesis and allowing more time for proper membrane insertion. Solubilization requires careful selection of detergents, with mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) typically providing good results for photosynthetic proteins. For functional studies, it may be necessary to reconstitute the purified protein into liposomes or nanodiscs to provide a membrane-like environment that supports native conformation and activity.

How can mutations in the psbB gene affect Photosystem II assembly and function?

Mutations in the psbB gene can have profound effects on Photosystem II assembly and function, with consequences that cascade throughout the photosynthetic apparatus. Complete disruption of the psbB gene results in total loss of Photosystem II activity, confirming CP47's essential role in PSII function . More subtle mutations can produce varied phenotypes depending on how they affect protein structure, chlorophyll binding, or interactions with other PSII components. Mutations in the conserved histidine residues hypothesized to be involved in chlorophyll binding would likely disrupt pigment organization and energy transfer efficiency, even if the protein still assembles into the complex .

The effects of psbB mutations can be observed at multiple levels of PSII organization. At the protein accumulation level, mutations affecting CP47 synthesis or stability lead to reduced protein levels, as seen in assembly factor mutants like fpb1 . At the complex assembly level, impaired CP47 accumulation results in altered PSII assembly patterns, with increased levels of assembly intermediates such as PSII monomers and CP43-less PSII complexes, coupled with reduced levels of fully assembled PSII dimers and supercomplexes . These assembly defects have functional consequences, including decreased photochemical efficiency, altered electron transport rates, and potentially increased susceptibility to photodamage. Interestingly, defects in PSII assembly due to CP47 issues can indirectly affect other photosynthetic complexes, as evidenced by the moderately reduced synthesis of PSI subunits in fpb1 mutants , highlighting the interconnected nature of photosynthetic complex biogenesis.

How does the polysome loading of psbB mRNA relate to CP47 synthesis rates?

This apparent paradox suggests that translation elongation or termination, rather than initiation, becomes rate-limiting in the absence of appropriate assembly factors like FPB1. The increased polysome association may represent ribosomes that are stalled or progressing more slowly along the mRNA, resulting in accumulation of ribosomes on transcripts without proportional protein synthesis. The puromycin-sensitivity of these heavy polysome fractions confirms that the psbB mRNA is indeed associated with ribosomes rather than non-ribosomal protein complexes . This finding highlights the importance of post-translational processes in regulating CP47 accumulation, where factors like FPB1 may facilitate proper folding or membrane integration of nascent CP47 polypeptides. The data suggest that translational regulation of CP47 synthesis involves complex mechanisms beyond simple control of translation initiation, with elongation rates potentially adjusted in response to the availability of assembly factors or in response to the status of PSII assembly.

What is the current understanding of how auxiliary proteins like FPB1 and PAM68 affect CP47 synthesis and PSII assembly?

Auxiliary proteins play crucial roles in facilitating CP47 synthesis and PSII assembly, with FPB1 and PAM68 emerging as particularly important factors. Research has demonstrated that FPB1 synergistically cooperates with PAM68 in the assembly of Photosystem II . In fpb1 mutants, despite normal transcript levels, CP47 synthesis is reduced to approximately 50% compared to wild type plants . This reduction is not due to impaired translation initiation, as polysome association with psbB transcripts is actually enhanced in these mutants . Instead, the data suggest that FPB1 likely functions in facilitating translation elongation or termination, perhaps by promoting proper folding or membrane integration of the nascent CP47 polypeptide.

Analysis of protein complex formation in fpb1 mutants reveals specific defects in PSII assembly. The majority of PSII subunits in these mutants accumulate in PSII monomers and CP43-less PSII complexes, with reduced levels of higher-order assemblies . Particularly notable is the near absence of the pre-CP47 complex in fpb1 mutants, suggesting a role for FPB1 in the early stages of CP47 integration into assembly intermediates . The synthesis of other PSII components, such as the PsbH protein that has been implicated in the photoinhibition-repair cycle, remains unaffected in fpb1 mutants . This indicates specificity in the function of FPB1 toward CP47 synthesis and early assembly steps. The moderately reduced synthesis of PSI subunits observed in fpb1 mutants appears to be a secondary effect of PSII deficiency, a phenomenon also observed in other PSII assembly mutants . This highlights the interconnected nature of photosynthetic complex biogenesis, where defects in one complex can influence the synthesis and assembly of others.

What are the optimal methods for isolating and analyzing PSII complexes containing recombinant CP47?

Isolating and analyzing PSII complexes containing recombinant CP47 requires a methodical approach that preserves complex integrity while enabling detailed characterization. Membrane isolation represents the first critical step, typically involving differential centrifugation to separate thylakoid membranes from other cellular components. Gentle solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin helps extract intact PSII complexes without disrupting critical protein-protein or protein-pigment interactions. The choice and concentration of detergent significantly impact which complexes are isolated, with gentler conditions favoring larger supercomplexes and more stringent conditions yielding smaller subcomplexes.

Blue native polyacrylamide gel electrophoresis (BN-PAGE) provides an excellent method for resolving different PSII assembly states, as demonstrated in studies of PSII assembly factor mutants . When combined with second-dimension SDS-PAGE (2D BN/SDS-PAGE), this technique enables visualization of both complex size and subunit composition, allowing researchers to track the incorporation of recombinant CP47 into various assembly intermediates . Western blotting using antibodies against CP47 or attached epitope tags can specifically detect the recombinant protein within these complexes. Sucrose density gradient ultracentrifugation offers an alternative approach for separating PSII complexes based on size and density, with the advantage of maintaining native interactions for subsequent functional studies. Functional characterization of isolated complexes can include spectroscopic analysis (absorption, fluorescence, and circular dichroism) to assess pigment binding and energy transfer, as well as oxygen evolution measurements to evaluate electron transport activity when appropriate electron acceptors are provided.

How can researchers effectively study CP47-chlorophyll interactions in recombinant systems?

Studying CP47-chlorophyll interactions in recombinant systems requires techniques that can probe both structural and functional aspects of these interactions. Absorption spectroscopy provides baseline information about chlorophyll binding, with characteristic spectral signatures indicating whether chlorophylls are properly coordinated within the protein environment. Steady-state fluorescence spectroscopy can reveal information about energy transfer between chlorophyll molecules, while time-resolved fluorescence measurements provide deeper insights into energy transfer kinetics and efficiency. Circular dichroism spectroscopy is particularly valuable for assessing the organization of pigments within the protein structure, as it is sensitive to the arrangement and coupling of chlorophylls.

Mutation analysis targeting the conserved histidine residues hypothesized to be involved in chlorophyll binding represents a powerful approach to identifying critical amino acids . Systematic replacement of these residues, followed by spectroscopic characterization, can establish structure-function relationships in chlorophyll binding. Resonance Raman spectroscopy offers detailed information about specific chlorophyll-protein interactions by probing vibrational modes influenced by the protein environment. For structural studies, hydrogen-deuterium exchange mass spectrometry can identify regions of the protein that interact with chlorophylls, as these regions typically show altered exchange rates due to their involvement in pigment binding. Reconstitution experiments, where purified recombinant CP47 is combined with chlorophylls under controlled conditions, can provide insights into the specificity and affinity of chlorophyll binding. These complementary approaches together create a comprehensive picture of how CP47 coordinates chlorophyll molecules for efficient light harvesting and energy transfer.

What techniques can reveal the dynamics of CP47 integration into PSII during assembly and repair processes?

Understanding the dynamics of CP47 integration into PSII during assembly and repair processes requires techniques that can track protein movement and complex formation over time. Pulse-chase experiments combined with immunoprecipitation allow researchers to follow newly synthesized CP47 as it progresses through assembly intermediates to fully assembled PSII. This approach has revealed that while most PSII complexes under repair do not release CP47, the extent of PSII disassembly depends on the severity of damage . Time-resolved analysis using BN-PAGE or sucrose density gradients can capture assembly intermediates at different stages, revealing the sequence of CP47 incorporation into higher-order structures.

Fluorescence recovery after photobleaching (FRAP) using fluorescently tagged CP47 can provide insights into protein mobility within membrane systems, potentially revealing differences between newly synthesized proteins and those undergoing recycling during repair processes. Chemical crosslinking combined with mass spectrometry can identify transient interaction partners of CP47 during various stages of assembly, potentially revealing assembly factors that temporarily associate with CP47 to facilitate its integration. Genetic approaches utilizing inducible expression systems for recombinant CP47 variants provide temporal control over protein production, allowing researchers to synchronize assembly processes for more detailed analysis. In vivo pulse labeling experiments, as demonstrated in studies of the fpb1 mutant , offer direct measurement of synthesis rates for CP47 and other photosynthetic proteins, providing context for understanding assembly dynamics. Together, these approaches can elucidate the complex processes governing CP47 integration into PSII during both de novo assembly and repair cycles.

How should researchers design experiments to study the effects of environmental factors on psbB expression and CP47 accumulation?

Designing experiments to study environmental influences on psbB expression and CP47 accumulation requires careful consideration of multiple factors. A systematic approach should include controlled growth conditions where specific environmental parameters (light intensity, temperature, humidity, CO2 levels) can be precisely manipulated while monitoring both psbB expression and CP47 protein levels. Time-course experiments are essential, as responses may vary between immediate effects and long-term acclimation. Sampling at multiple timepoints after changing conditions can distinguish between transient responses and stable adaptation mechanisms.

What analytical approaches can differentiate between direct and indirect effects on CP47 in experimental studies?

Differentiating between direct and indirect effects on CP47 in experimental studies requires multiple analytical approaches and careful experimental design. Comprehensive protein analysis examining changes across the entire photosynthetic apparatus helps identify whether effects are specific to CP47 or part of broader responses affecting multiple components. If only CP47 is affected while other PSII proteins remain unchanged, this suggests a direct effect. Time-course experiments can reveal the sequence of molecular events following experimental manipulation, helping establish cause-and-effect relationships. If changes in CP47 precede alterations in other components, this supports a direct effect on CP47.

Gene-specific manipulation through techniques like site-directed mutagenesis targeting only psbB provides the most direct evidence for CP47-specific effects. Complementation experiments, where wild-type CP47 is reintroduced into affected systems, can confirm whether observed phenotypes are directly attributable to CP47 alterations. Comparing experimental results with known assembly or regulatory mutants, such as fpb1 and pam68 , can help interpret observed phenotypes in the context of established regulatory mechanisms. Correlation analysis between CP47 levels and functional parameters can help establish whether physiological changes scale proportionally with CP47 abundance, supporting a direct causal relationship. Structural analysis of PSII complexes using techniques like BN-PAGE followed by Western blotting helps determine whether experimental manipulations affect CP47 incorporation into complexes or disrupt specific assembly steps . These multiple lines of evidence, when considered together, provide a more complete picture of how experimental manipulations directly or indirectly affect CP47.

How can researchers interpret changes in polysome loading of psbB transcripts in relation to CP47 synthesis rates?

Interpreting the relationship between polysome loading of psbB transcripts and CP47 synthesis rates requires careful consideration of translational dynamics. Research has shown that these parameters can be unexpectedly disconnected, as demonstrated in the fpb1 mutant where enhanced polysome association coincided with reduced CP47 synthesis . This apparent paradox provides important insights into translational regulation mechanisms. When increased polysome loading is observed alongside reduced protein synthesis, this strongly suggests issues with translation elongation or termination rather than initiation. Researchers should consider whether ribosomes might be stalled or progressing more slowly along the transcript, resulting in accumulation without proportional protein production.

Validation with puromycin treatment, which specifically disassembles ribosomes, can confirm that heavy fractions truly represent polysome-associated mRNA rather than non-ribosomal complexes . Comparing polysome profiles across multiple transcripts helps determine whether observed effects are specific to psbB or reflect global translational changes. In the fpb1 mutant, the enhanced polysome association was specific to psbB transcripts, while other photosynthetic gene transcripts showed normal distribution patterns . Analysis of translation intermediates might reveal whether incomplete CP47 peptides accumulate, suggesting premature translation termination. Correlation with assembly factor availability can indicate whether translation rates are adjusted based on the capacity for downstream processing and assembly. These analytical approaches together can help researchers interpret the complex relationship between polysome loading and protein synthesis rates, revealing regulatory mechanisms that coordinate translation with assembly processes.

What statistical approaches are most appropriate for analyzing data from CP47 functional studies?

Analyzing data from CP47 functional studies requires robust statistical approaches that can account for biological variation while detecting meaningful differences. For comparing CP47 synthesis rates or accumulation levels between experimental treatments, paired statistical tests like paired t-tests or repeated measures ANOVA are often appropriate when measurements come from the same biological samples under different conditions. These tests increase statistical power by controlling for sample-to-sample variability. When analyzing complex datasets with multiple variables, such as CP47 levels across different assembly states, multivariate statistical methods like principal component analysis (PCA) can help identify patterns and relationships not evident in univariate analyses.

Correlation analyses are valuable for examining relationships between CP47 levels and functional parameters like photosynthetic efficiency, helping establish whether physiological effects scale with molecular changes. For time-course experiments tracking CP47 synthesis or assembly, regression analysis or mixed-effects models can accommodate the non-independence of repeated measurements while identifying significant trends over time. When analyzing spectroscopic data from CP47-chlorophyll interaction studies, spectral deconvolution approaches help separate overlapping signals and quantify specific components. Meta-analysis techniques can be particularly valuable when combining results from multiple experiments or comparing findings across different Sorghum varieties, increasing statistical power and revealing consistent patterns across diverse datasets. Regardless of the specific statistical approach, researchers should clearly report both effect sizes and measures of statistical significance, as physiologically meaningful effects might not always correlate with statistical significance thresholds.

What are the current challenges in producing functional recombinant CP47 protein for structural studies?

How might comparative studies of CP47 from different Sorghum varieties inform crop improvement strategies?

Researchers could correlate CP47 characteristics with agronomically important traits such as yield, drought tolerance, or heat resistance across different Sorghum varieties. Such correlations might identify specific CP47 variants associated with enhanced performance under challenging conditions. Studying varieties adapted to extreme environments might reveal specialized modifications in CP47 structure or regulation that contribute to stress resilience. This knowledge could guide precision breeding approaches targeting specific CP47 variants or regulatory elements. Given the complex regulation of CP47 synthesis involving auxiliary factors like FPB1 and PAM68 , comparative studies should extend beyond the psbB gene itself to include these regulatory components. Variations in these factors might influence CP47 accumulation and PSII assembly efficiency across different varieties. Ultimately, identifying naturally optimized versions of CP47 and its regulatory machinery could provide valuable genetic resources for developing Sorghum varieties with enhanced photosynthetic performance under various environmental conditions.

What emerging technologies are advancing our ability to study CP47 integration into photosynthetic membranes?

Emerging technologies are significantly enhancing our ability to study CP47 integration into photosynthetic membranes, opening new research frontiers. Cryo-electron microscopy has revolutionized structural biology of membrane protein complexes, enabling high-resolution visualization of CP47 within the PSII complex without requiring crystallization. This technique can potentially capture different assembly intermediates, providing insights into the structural changes accompanying CP47 integration. Advanced fluorescence microscopy techniques, including super-resolution approaches like PALM (Photoactivated Localization Microscopy) and STORM (Stochastic Optical Reconstruction Microscopy), offer unprecedented spatial resolution for tracking CP47 localization and movement within thylakoid membranes.

Single-molecule tracking methodologies can follow individual CP47 proteins during membrane integration and complex assembly, revealing heterogeneity and dynamic behaviors not apparent in bulk measurements. Expanding beyond traditional model organisms, CRISPR-Cas9 gene editing now enables precise modification of the psbB gene directly in Sorghum bicolor, allowing in vivo studies of CP47 variants in their native context. Synthetic biology approaches, including the development of minimal photosynthetic systems with defined components, provide controlled environments for studying CP47 integration processes. Advanced mass spectrometry techniques like hydrogen-deuterium exchange mass spectrometry (HDX-MS) and crosslinking mass spectrometry (XL-MS) offer new approaches for mapping protein-protein interactions during assembly. These technologies, combined with computational modeling of membrane protein integration, are creating unprecedented opportunities for understanding the complex processes governing CP47 incorporation into photosynthetic membranes.

How might research on recombinant CP47 contribute to bioengineering approaches for improved photosynthesis?

Research on recombinant CP47 offers significant potential for bioengineering approaches aimed at improving photosynthetic efficiency. Understanding the structural determinants of efficient light harvesting and energy transfer in CP47 could inform targeted modifications designed to optimize these processes. Engineered CP47 variants with altered chlorophyll binding properties might expand the spectral range of light absorption, potentially increasing the total light energy captured for photosynthesis. Structure-function studies focusing on the histidine residues involved in chlorophyll binding could guide precision engineering of pigment-protein interactions to enhance energy transfer efficiency or reduce energy losses through non-productive pathways.

Beyond light harvesting, research on CP47's role in PSII assembly and repair cycles could identify bottlenecks limiting photosynthetic efficiency under field conditions. Enhanced understanding of how auxiliary factors like FPB1 and PAM68 facilitate CP47 synthesis and integration might inform strategies to optimize these processes, potentially accelerating PSII repair and reducing downtime following photodamage. Environmental stress frequently targets PSII, making it a limiting factor in crop productivity. Engineered CP47 variants with enhanced stability under stress conditions could potentially improve crop resilience and yield stability under suboptimal growing conditions. As climate change intensifies environmental challenges for agriculture, research on how CP47 structure and function can be optimized for these changing conditions becomes increasingly valuable. The fundamental knowledge gained from recombinant CP47 research thus provides a scientific foundation for bioengineering approaches to enhance photosynthetic efficiency and crop productivity in a changing world.

What key considerations should guide researchers designing experiments with recombinant Sorghum bicolor CP47?

Researchers working with recombinant Sorghum bicolor CP47 should consider several critical factors to maximize experimental success and data reliability. Expression system selection requires careful evaluation of each platform's capacity to support chlorophyll synthesis or incorporation, as proper CP47 folding depends on pigment binding. The presence of five pairs of histidine residues in hydrophobic regions, likely involved in chlorophyll binding , highlights the importance of maintaining these structural features in recombinant constructs. Purification strategies must preserve delicate protein-pigment interactions through carefully selected buffers, detergents, and handling procedures. Researchers should consider that CP47 functions as an integral part of a multiprotein complex, and its properties when isolated may differ from its native state within PSII.

Experimental design should include appropriate controls to distinguish direct effects of CP47 manipulation from indirect effects on other photosynthetic components. As demonstrated in studies of assembly factor mutants, impaired CP47 synthesis can have cascading effects on PSII assembly and even influence other complexes like PSI . When analyzing polysome loading data, researchers should remember that increased ribosome association does not necessarily correlate with increased protein synthesis, as shown in the fpb1 mutant where enhanced polysome loading coincided with reduced CP47 synthesis . This apparent paradox highlights the complex translational regulation of CP47 and the importance of complementary approaches measuring actual protein synthesis rates. For functional studies, researchers should consider that environmental conditions can significantly influence photosynthetic protein dynamics, necessitating careful control of variables like light intensity, temperature, and nutrient availability. These considerations, when properly addressed, enable more robust and reliable research outcomes when working with this complex photosynthetic protein.

Selected Insights into CP47 Structure and Function
CP47 contains five pairs of histidine residues spaced by 13-14 amino acids in hydrophobic regions, likely involved in chlorophyll binding
Interruption of the psbB gene results in complete loss of Photosystem II activity, demonstrating CP47's essential role
Most PSII complexes undergoing repair do not release CP47, indicating its structural importance
In fpb1 mutants, CP47 synthesis is reduced to ~50% despite enhanced polysome loading of psbB transcripts
Assembly factor mutations lead to accumulation of PSII monomers and CP43-less PSII complexes
Defects in PSII assembly due to impaired CP47 synthesis can indirectly affect other photosynthetic complexes

What are the most promising future research directions for Sorghum bicolor CP47 studies?

The future of Sorghum bicolor CP47 research holds several promising directions that could advance both fundamental understanding and applied aspects of photosynthesis research. Comparative genomic and structural analyses of CP47 across diverse Sorghum varieties could reveal adaptive variations associated with environmental resilience, potentially identifying naturally optimized variants for crop improvement. Detailed structure-function studies focusing on the conserved histidine residues hypothesized to be involved in chlorophyll binding could provide insights into the molecular basis of efficient light harvesting and energy transfer. This knowledge could guide precision engineering approaches to enhance photosynthetic efficiency.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.