Recombinant Southern cowpea mosaic virus Replicase polyprotein P2AB (ORF2A-2B)

Shipped with Ice Packs
In Stock

Description

Biological Role in Viral Replication

SCPMV P2AB is a multifunctional polyprotein encoded by overlapping ORF2A and ORF2B. Key functional insights include:

Polyprotein Processing

  • Protease Activity: Autocatalytically cleaves itself into N-terminal protein, serine protease, VPg, and RdRp .

  • Frameshifting Mechanism: ORF2B (RdRp) is translated via a −1 programmed ribosomal frameshift (PRF) during ORF2A translation, occurring at ~10–20% efficiency .

Research Applications

This recombinant protein is widely used in:

  • Viral Replication Studies: Investigating ribosomal frameshifting mechanisms and protease-RdRp interactions .

  • Antiviral Development: Screening inhibitors targeting sobemoviral protease or RdRp .

  • Structural Biology: Crystallography and cryo-EM studies to resolve replication complex architectures .

Comparative Analysis with Southern Bean Mosaic Virus (SBMV)

SCPMV P2AB shares 85% sequence identity with SBMV P2AB (UniProt: O72157), differing primarily in:

FeatureSCPMV P2ABSBMV P2AB
Amino Acid Range403–956403–962
VPg MotifSFDGALPLNLLAGGRTQC...TVAEPLNLPAGGRVKAL...
RdRp Active SiteGDD (positions 812–814)GDD (positions 818–820)

Key Research Findings

  • Leaky Scanning Translation: Ribosomes bypass ORF1’s weak initiation codon to translate ORF2A, confirmed via in vitro cap analog sensitivity .

  • ORFx Overlap: A recently discovered upstream ORFx overlaps with ORF2A’s 5′ region, modulating replication efficiency in related sobemoviruses .

Handling and Limitations

  • Stability: Degrades rapidly if reconstituted improperly; glycerol stabilizes but may interfere with assays .

  • Non-Human Use: Strictly for research purposes .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
ORF2A-2B; Replicase polyprotein P2AB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
403-956
Protein Length
Full Length of Mature Protein
Species
Southern cowpea mosaic virus (SCPMV) (Southern bean mosaic virus (strain cowpea))
Target Names
ORF2A-2B
Target Protein Sequence
SFDGALPLNLLAGGRTQCLAAQIELGDYKFSCGPTHETGGMPFRNCGSSTCKFREVSRKP VADAVTAATKVFPELSELGWPERGSGAEIGSLLLQAGKFVPTKAPSNLEQAYNNLLSRYP RSKPLACFRQGTWSFDAIFEQVVSKATSAEINQKASPGVPLSRLATTNKDLMAQHMQFVA ACVTGRVPLLASFEDIHALSPTEMVEMGLCDPVRLFVKQEPHPSRKLKEGRYRLISSVSI VDQLVERMLFGAQNELEIAEWQSIPSKPGMGLSVIHQADAIFRDLRVKHTVCPAAEADIS GFDWSVQDWELWADVEMRIVLGSFPPMMARAARNRFSCFMNSVLQLSNGQLLQQELPGIM KSGSYCTSSTNSRIRCLMAELIGSPWCIAMGDDSVEGFVEGAREKYAGLGHLCKDYKPCA TTPTGQLYAVEFCSHVIKRNKAFLTSWPKTLYRFLSTPRETLEDLERELASSPMWHKIQS YVRSIPSPDKTARDKSICNGYPLDQEAISTSYSEYSSKSASAEATREAACCAGAQAYPSW GIHGPYCSGDHGEA
Uniprot No.

Target Background

Function
This protein is responsible for cleavages of polyprotein P2A and replicase polyprotein P2AB. It is covalently attached to the 5' extremity of the genomic and subgenomic RNAs, potentially serving as a primer for the replicase. This protein is also involved in replicating the viral genome.
Database Links

KEGG: vg:1481842

Subcellular Location
[N-terminal protein]: Host membrane; Multi-pass membrane protein.; [Replicase polyprotein P2AB]: Host membrane; Multi-pass membrane protein.

Q&A

What is the Southern cowpea mosaic virus Replicase polyprotein P2AB?

The Replicase polyprotein P2AB is a multifunctional viral protein encoded by ORF2A-2B in the SCPMV genome. According to structural analysis, P2AB is cleaved into four distinct functional chains: N-terminal protein, Serine protease (EC 3.4.21.-), VPg, and RNA-directed RNA polymerase (EC 2.7.7.48) . The full amino acid sequence spans positions 403-956 of the viral genome, forming a complex protein machinery essential for viral replication.

Methodologically, researchers typically study this protein through:

  • Genome sequence analysis and domain prediction

  • Heterologous expression in bacterial, yeast, or plant-based systems

  • Functional characterization through enzymatic assays

  • Structural determination of individual domains or the complete polyprotein

How does Southern cowpea mosaic virus relate to other sobemoviruses?

SCPMV was previously classified together with Southern bean mosaic virus (SBMV) but is now recognized as a separate species within the Sobemovirus genus . Sobemoviruses constitute a group of plant viruses characterized by:

  • Single-component positive-sense RNA genomes

  • Beetle transmission (for many members including SCPMV)

  • Similar genome organization and replication strategies

  • Primarily infecting either dicotyledonous or monocotyledonous plants

Methodologically, classification and comparative studies involve:

  • Full genome sequencing and phylogenetic analysis

  • Host range determination through infection studies

  • Vector specificity identification

  • Analysis of replication mechanisms and protein functions

What are the known functional domains of SCPMV Replicase polyprotein P2AB?

The SCPMV Replicase polyprotein P2AB contains multiple functional domains that work in concert for viral genome replication:

DomainFunctionApproximate Position
N-terminal proteinProtein-protein interactionsN-terminus
Serine proteasePolyprotein processingMiddle region
VPg (Viral Protein genome-linked)Primer for RNA synthesisMiddle region
RNA-directed RNA polymeraseViral RNA synthesisC-terminus

The amino acid sequence revealed in the research data includes conserved motifs characteristic of each domain, including the SFDGALPLNL sequence at the N-terminus and multiple catalytic residues throughout the protein .

What expression systems are optimal for producing recombinant SCPMV Replicase polyprotein?

Based on available research data, recombinant SCPMV Replicase polyprotein P2AB can be produced in various expression systems, each with specific advantages:

Expression SystemAdvantagesChallengesYield
E. coliSimplicity, low cost, rapid growthPossible misfolding, inclusion bodiesPotentially high
Plant-basedNatural host environment, proper foldingSlower growth, more complexModerate
Insect cell/BaculovirusPost-translational modificationsHigher cost, technical complexityVariable

For optimal storage and handling of the recombinant protein:

  • Store in Tris-based buffer with 50% glycerol

  • Maintain at -20°C for short-term storage

  • Use -80°C for extended storage

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be kept at 4°C for up to one week

How can researchers study the enzymatic activities of SCPMV Replicase polyprotein components?

The multifunctional nature of SCPMV Replicase polyprotein requires specific methodologies to study its various enzymatic activities:

  • RNA-dependent RNA polymerase (RdRp) activity:

    • In vitro RNA synthesis assays using purified RdRp domain

    • Template-dependent incorporation of labeled nucleotides

    • Analysis of RNA products by gel electrophoresis

  • Protease activity:

    • Cleavage assays using fluorogenic peptide substrates

    • Trans-cleavage assays to study processing of viral polyproteins

    • Inhibitor studies to characterize protease specificity

  • RNA binding:

    • Electrophoretic mobility shift assays (EMSA)

    • Filter binding assays

    • Surface plasmon resonance for binding kinetics

When comparing the SCPMV replication complex with other viral systems, researchers must consider the unique structural arrangements and enzymatic properties of each component.

What approaches can be used to develop full-length cDNA clones of SCPMV for functional studies?

Full-length cDNA clones serve as powerful tools for studying SCPMV replication and protein function. Research on related sobemoviruses provides methodological guidance:

  • Construction strategy:

    • RT-PCR amplification of viral genomic fragments

    • Assembly using unique restriction sites or Gibson assembly

    • Placement under control of T7 or CaMV 35S promoter

    • Addition of ribozyme sequences for precise 3' end formation

  • Validation approaches:

    • In vitro transcription and RNA transfection into protoplasts

    • Direct DNA inoculation into host plants

    • Analysis of viral replication by Northern blotting

    • Detection of viral proteins using specific antibodies

  • Mutagenesis for functional studies:

    • Site-directed mutagenesis of catalytic residues

    • Domain swapping with related viruses

    • Deletion analysis to identify essential regions

    • Reporter gene insertion for tracking viral movement

Studies with other sobemoviruses have shown that mutants lacking functional P1 protein can replicate in protoplasts but fail to establish systemic infection, highlighting the role of P1 in viral movement rather than replication .

How does the replication mechanism of SCPMV compare to other plant viruses?

Comparative analysis of viral replication mechanisms provides insights into conservation and divergence among plant viruses:

VirusReplication SiteKey Replication ProteinsMembrane Rearrangements
SCPMVMembranous vesiclesReplicase polyprotein P2ABLikely ER-derived
CPMVER-derived vesicles32K and 60K proteinsExtensive ER modifications
RYMVNot specified in dataP1 (for movement, not replication)Not specified in data

Methodological approaches for comparative studies include:

  • Electron microscopy of infected cells

  • Immunogold labeling of viral replication proteins

  • Biochemical characterization of purified replication complexes

  • Heterologous expression of replication proteins in model plants

A notable difference between CPMV and SCPMV is that CPMV 32K and 60K proteins cause necrosis when expressed individually in N. benthamiana, suggesting cytotoxicity, whereas during natural infection, these proteins accumulate without causing necrosis .

What potential applications exist for SCPMV as a biotechnological platform?

While specific applications of SCPMV are not directly addressed in the provided data, related plant viruses like CPMV demonstrate significant biotechnological potential:

  • Vaccine development:

    • CPMV has been successfully used to display NY-ESO-1 cancer antigen peptides

    • The resulting CPMV-NY-ESO-1 vaccine stimulated potent CD8+ T cell responses

    • Transgenic mice immunized with CPMV-NY-ESO-1 showed antigen-specific T cell proliferation and cancer cell cytotoxicity

  • Potential SCPMV applications:

    • Antigen display platform for vaccines

    • Gene expression vector for plants

    • Protein scaffold for nanotechnology

    • Imaging agent development

Methodologically, adapting SCPMV for biotechnological applications would involve:

  • Chemical or genetic modification of viral particles

  • In vitro and in vivo testing of modified particles

  • Optimization of production systems

  • Safety and efficacy assessment

How can researchers optimize the purification of recombinant SCPMV Replicase polyprotein?

Purification of recombinant SCPMV Replicase polyprotein presents challenges due to its size, potential membrane association, and multiple domains. Based on available research data, optimization strategies include:

  • Solubility enhancement:

    • Fusion with solubility tags (MBP, SUMO, GST)

    • Co-expression with chaperones

    • Optimization of buffer conditions

    • Partial purification of functional domains

  • Chromatography strategy:

    • Initial capture using affinity chromatography

    • Intermediate purification by ion exchange

    • Polishing step using size exclusion chromatography

    • Specific protocols for membrane-associated proteins if needed

  • Quality assessment:

    • SDS-PAGE analysis for purity

    • Western blotting for identity confirmation

    • Mass spectrometry for detailed characterization

    • Activity assays for functional validation

Typical yields for recombinant viral proteins range from 1-10 mg/L in bacterial systems to lower but potentially more active yields in eukaryotic expression systems.

What controls should be included when studying SCPMV Replicase polyprotein activity?

  • Positive controls:

    • Well-characterized viral RNA polymerases (e.g., from bacteriophages)

    • Known functional domains from related viruses

    • Wild-type protein for comparison with mutants

  • Negative controls:

    • Catalytically inactive mutants (e.g., polymerase active site mutations)

    • Unrelated proteins of similar size

    • Buffer-only reactions

  • Internal controls:

    • Housekeeping genes for normalization in expression studies

    • Spike-in standards for quantitative assays

    • Parallel reactions under different conditions

  • Validation approaches:

    • Multiple independent methods to confirm the same finding

    • Dose-response relationships for enzymatic activities

    • Time-course experiments to establish kinetics

These controls help distinguish specific effects from experimental artifacts and provide benchmarks for comparing results across different studies.

How can researchers effectively analyze the structure-function relationship of SCPMV Replicase polyprotein?

Understanding the structure-function relationship of SCPMV Replicase polyprotein requires integrated approaches:

  • Structural analysis:

    • X-ray crystallography of individual domains

    • Cryo-electron microscopy for larger complexes

    • NMR spectroscopy for dynamic regions

    • Computational modeling based on homologous structures

  • Functional mapping:

    • Alanine scanning mutagenesis of conserved residues

    • Chimeric proteins with domains from related viruses

    • Deletion analysis to define minimal functional units

    • Targeted mutations based on structural information

  • Correlation methods:

    • Statistical coupling analysis to identify co-evolving residues

    • Molecular dynamics simulations to predict conformational changes

    • Deep mutational scanning for comprehensive functional assessment

When applying these approaches, researchers should consider that viral proteins often have structural elements that serve multiple functions, complicating the analysis of individual mutations.

How should researchers address conflicting results in SCPMV replication studies?

Conflicting results are common in viral replication studies and require systematic approaches to resolution:

  • Methodological differences:

    • Compare experimental conditions (temperature, pH, salt concentration)

    • Evaluate protein expression systems and purification methods

    • Consider differences in assay sensitivity and specificity

  • Biological variables:

    • Host species and cultivar variations

    • Viral isolate differences

    • Environmental factors affecting viral replication

  • Resolution strategies:

    • Direct replication of conflicting studies under identical conditions

    • Collaborative cross-laboratory validation

    • Meta-analysis of multiple independent studies

    • Development of standardized protocols

An example from related research shows that CPMV replication proteins exhibit different behaviors when expressed individually versus during natural infection, suggesting context-dependent functionality that must be considered when interpreting experimental results .

What are the implications of SCPMV research for understanding broader principles of viral replication?

Research on SCPMV contributes to fundamental understanding of viral replication mechanisms:

  • Common principles:

    • Membrane association of viral replication complexes

    • Multifunctional viral proteins with specialized domains

    • Interactions between viral and host factors

    • Coordination of translation, replication, and encapsidation

  • Evolutionary perspectives:

    • Conservation of replication mechanisms across virus families

    • Adaptation to different host environments

    • Selection pressures on viral replication machinery

  • Translational implications:

    • Development of broad-spectrum antiviral strategies

    • Engineering of virus resistance in crop plants

    • Design of viral vectors for biotechnology applications

By studying the specialized replication machinery of SCPMV, researchers gain insights applicable to other positive-strand RNA viruses that impact agriculture and human health.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.