Recombinant Spalax ehrenbergi 5-hydroxytryptamine receptor 1B (HTR1B)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Spalax ehrenbergi 5-Hydroxytryptamine Receptor 1B (HTR1B)

Recombinant Spalax ehrenbergi 5-hydroxytryptamine receptor 1B (HTR1B) is a synthetic protein derived from the Middle East blind mole rat (Spalax ehrenbergi), engineered for research purposes. It belongs to the serotonin receptor family, specifically the 5-HT1B subtype, which is a G protein-coupled receptor (GPCR) involved in modulating neurotransmitter release, pain perception, mood regulation, and vasoconstriction . This recombinant variant is produced via heterologous expression systems (e.g., E. coli, yeast, or mammalian cells) and is used to study receptor-ligand interactions, signal transduction mechanisms, and therapeutic applications .

Molecular Structure and Functional Characteristics

The HTR1B receptor consists of seven transmembrane (TM) domains with an extracellular N-terminus and intracellular C-terminus. Key structural features include:

  • Orthosteric Binding Pocket: Binds serotonin (5-HT), ergot alkaloids, and synthetic agonists/antagonists .

  • G Protein Coupling: Activates G<sub>i/o</sub> proteins, inhibiting adenylate cyclase and modulating downstream signaling pathways .

  • Species-Specific Variations: The Spalax ehrenbergi HTR1B shares ~85% sequence homology with human HTR1B but exhibits distinct pharmacological profiles due to amino acid substitutions (e.g., Thr335 vs. Asn in rodents) .

Table 1: Key Ligands and Binding Affinity for HTR1B

Ligand TypeExample CompoundsBinding Affinity (pK<sub>B</sub>)Reference
AgonistsDonitriptan, Frovatriptan10.0 (L694247)
AntagonistsGR55562, SB2242897.4–8.9

Functional Assays

  • cAMP Inhibition: Recombinant HTR1B inhibits cAMP production in cell-based luciferase assays when activated by 5-HT or agonists like CP94253 .

  • MAPK/ERK Signaling: Activation of HTR1B stimulates the MAPK/ERK pathway, as shown in chicken pituitary studies .

Table 2: Common Research Applications

ApplicationMethodologyOutcomeReference
Ligand ScreeningRadioligand Binding AssaysAffinity (K<sub>d</sub>) determination
Signal TransductioncAMP/G Protein CouplingInhibition of adenylate cyclase
Structural BiologyX-ray/Cryo-EMConformational changes (TM6)

Species-Specific Pharmacology

  • Rodent vs. Human: Spalax HTR1B exhibits reduced affinity for certain ligands (e.g., cyanopindolol) due to a Thr335 → Asn substitution, highlighting species-specific binding profiles .

  • Agonist-Induced Conformational Changes: Ergotamine (agonist) stabilizes an active state, while methiothepin (inverse agonist) promotes TM6 outward movement, critical for G protein coupling .

Behavioral and Pathophysiological Implications

  • Aggression and Depression: A human polymorphism (A/G) in the HTR1B mRNA modulates miR-96-mediated repression, with A-homozygotes showing increased aggression-related behaviors .

  • Emotional Memory: In p11 knockout mice (a model of depression), HTR1B agonists reverse memory deficits by enhancing glutamatergic neurotransmission in the hippocampus .

Production and Purification of Recombinant Spalax HTR1B

Recombinant HTR1B is produced via:

  • Expression Systems: E. coli, yeast, baculovirus, or mammalian cells (e.g., HEK293) .

  • Tags: His-tag, Avi-tag, or SUMO-tag for purification .

  • Purity: ≥85% via SDS-PAGE, with glycerol stabilization for storage .

Table 3: Production Parameters

ParameterDetailsReference
Host SystemsE. coli, Yeast, Mammalian Cells
TagsHis, Avi, SUMO
Storage Conditions-20°C/-80°C in Tris buffer + glycerol

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, should you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs unless otherwise specified. If dry ice shipment is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development accordingly.
Synonyms
HTR1B; 5HT1B; 5-hydroxytryptamine receptor 1B; 5-HT-1B; 5-HT1B; Serotonin receptor 1B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
full length protein
Species
Spalax ehrenbergi (Middle East blind mole rat) (Nannospalax ehrenbergi)
Target Names
Target Protein Sequence
MEEPGARCAPPPPAGSQTQTPSSNLSHNCSADSYIYQDSIALPWKVLLVALLALITLATT LSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDF WLSSDITCCTASIMHLCVIALDRYWAITDAVEYSAKRTPRRAAVMIALVWVFSISISLPR FFWRQAKAEEEVLDCLVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRILKQTP NKTGKRLSRAQLISDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLEKKKL MAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMAIFDFFNWLGYLNSLI NPIIYTMPNEDFKQAFHKLIRFKCTG
Uniprot No.

Target Background

Function
This G-protein coupled receptor, specific to 5-hydroxytryptamine (serotonin), also serves as a receptor for various alkaloids and psychoactive substances. Ligand binding triggers a conformational change, initiating signaling through guanine nucleotide-binding proteins (G proteins) and modulating the activity of downstream effectors, such as adenylate cyclase. This signaling inhibits adenylate cyclase activity. Members of the arrestin family inhibit signaling via G proteins and mediate the activation of alternative signaling pathways. It regulates the release of 5-hydroxytryptamine, dopamine, and acetylcholine in the brain, thereby influencing neural activity, nociceptive processing, pain perception, mood, and behavior. Additionally, it plays a role in vasoconstriction of cerebral arteries.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Spalax ehrenbergi HTR1B and why is it significant for neuroscience research?

Spalax ehrenbergi HTR1B (5-hydroxytryptamine receptor 1B) is a serotonin receptor expressed in the Middle East blind mole rat (Nannospalax ehrenbergi). This receptor is particularly significant for neuroscience research due to its role in regulating serotonin transmission via presynaptic mechanisms, affecting neurotransmitter release at heterosynaptic sites . The blind mole rat represents an exceptional model organism for studying the serotonergic system in the context of extreme environmental adaptations, particularly given their solitary, territorial, and aggressive behavior patterns . Their specialized sensory systems and neurological adaptations to subterranean life provide unique insights into how serotonin receptor systems may evolve under specific environmental pressures.

How should recombinant Spalax ehrenbergi HTR1B be properly stored and handled for experimental use?

For optimal storage and handling of recombinant Spalax ehrenbergi HTR1B:

  • Storage temperature: Maintain at -20°C or -80°C for long-term preservation .

  • Shelf life: Typically 6 months for liquid preparations and 12 months for lyophilized forms when stored at -20°C/-80°C .

  • Reconstitution protocol: Briefly centrifuge vials before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Glycerol addition: Add 5-50% glycerol (final concentration) to prevent freeze damage during storage .

  • Working aliquots: Store at 4°C for up to one week to minimize freeze-thaw cycles .

  • Freeze-thaw cycles: Avoid repeated freezing and thawing as this can compromise protein integrity and activity .

When designing experiments, researchers should prepare appropriately sized aliquots based on anticipated usage to minimize freeze-thaw cycles and maintain consistent protein activity across experiments.

What are the recommended methods for functional characterization of recombinant Spalax ehrenbergi HTR1B?

For functional characterization of recombinant Spalax ehrenbergi HTR1B, researchers should consider a multi-tier approach:

Receptor Binding Assays:

  • Radio-ligand binding assays using tritiated serotonin or specific 5-HT1B ligands

  • Competitive binding studies with known 5-HT1B agonists and antagonists

  • Saturation binding analyses to determine receptor density and affinity constants

Signal Transduction Assays:

  • cAMP inhibition assays (as 5-HT1B couples to Gi/o proteins)

  • GTPγS binding assays to measure G protein activation

  • Calcium mobilization studies using fluorescent calcium indicators

Functional Cellular Assays:

  • Electrophysiological recordings in heterologous expression systems

  • Neurotransmitter release studies in synaptosome preparations

  • Migration and proliferation assays in relevant cell types

These methodologies should be complemented by comparisons with 5-HT1B receptors from other species to identify Spalax-specific functional adaptations that may relate to their unique environmental niche and behavioral characteristics .

How can researchers effectively compare HTR1B function between Spalax ehrenbergi and other species?

Effective comparative analysis of HTR1B function between Spalax ehrenbergi and other species requires systematic approaches across multiple levels:

Sequence and Structural Analysis:

  • Multiple sequence alignments to identify conserved and divergent regions

  • Homology modeling to predict structural differences in binding domains

  • Molecular dynamics simulations to examine receptor conformational changes

Pharmacological Profiling:

  • Comparative dose-response curves with standard 5-HT1B agonists/antagonists

  • Species-specific ligand selectivity and binding affinity determination

  • Allosteric modulation patterns across species variants

Signaling Pathway Comparison:

  • G-protein coupling efficiency and subtype preference

  • Downstream effector activation kinetics and magnitude

  • Receptor desensitization and internalization rates

Physiological Context:

  • Expression pattern comparison across brain regions and peripheral tissues

  • Receptor regulation under hypoxic conditions (particularly relevant for Spalax)

  • Functional interaction with adapter proteins (e.g., p11) that influence receptor activity

This comparative approach can reveal how HTR1B function in Spalax ehrenbergi has evolved in response to its subterranean lifestyle, hypoxic environment, and distinct behavioral patterns.

What experimental controls should be included when working with recombinant Spalax ehrenbergi HTR1B?

When designing experiments with recombinant Spalax ehrenbergi HTR1B, researchers should implement the following critical controls:

Expression System Controls:

  • Empty vector transfection controls

  • Wild-type vs. tagged protein comparisons to assess tag interference

  • E. coli-derived contaminant controls when using bacterially expressed protein

Protein Quality Controls:

  • SDS-PAGE analysis to confirm >85% purity

  • Western blotting with anti-HTR1B antibodies

  • Mass spectrometry verification of protein identity

Functional Assay Controls:

  • Positive controls using well-characterized 5-HT1B agonists (e.g., sumatriptan)

  • Negative controls using selective antagonists (e.g., GR127935)

  • Comparative controls with human or mouse 5-HT1B receptors

Specificity Controls:

  • Structurally-related receptor controls (e.g., 5-HT1A, 5-HT1D)

  • Concentration gradients to establish dose-dependent effects

  • Time-course studies to determine temporal response patterns

Including these controls ensures experimental rigor and facilitates accurate interpretation of results, particularly when investigating species-specific adaptations of the receptor.

What methodologies are recommended for studying the role of HTR1B in the unique behavioral characteristics of Spalax ehrenbergi?

Investigating HTR1B's role in Spalax ehrenbergi's distinctive behavioral phenotype requires specialized methodological approaches:

Behavioral Phenotyping with Pharmacological Manipulation:

  • Selective 5-HT1B agonist/antagonist administration coupled with behavioral assays for aggression, territoriality, and stress responses

  • Microdialysis studies measuring serotonin release in behaviorally relevant brain regions during social and territorial challenges

  • Controlled hypoxia experiments to assess behavioral adaptation mechanisms

Molecular Neuroanatomy:

  • High-resolution mapping of HTR1B expression across brain regions using in situ hybridization and immunohistochemistry

  • Comparative analysis with social rodent species to identify differences in receptor distribution

  • Co-localization studies with other neurotransmitter systems involved in social behavior

Functional Manipulation Approaches:

  • Viral-mediated gene transfer for region-specific HTR1B manipulation

  • CRISPR-Cas9 editing to introduce species-specific HTR1B variants

  • Optogenetic or chemogenetic control of HTR1B-expressing neurons

These approaches should be developed with consideration for the unique characteristics of Spalax ehrenbergi, including their solitary, territorial nature and specialized sensory systems for communication and navigation in underground environments .

What are the potential interactions between HTR1B and adapter proteins in Spalax ehrenbergi, and how do they compare with other species?

The interaction between HTR1B and adapter proteins in Spalax ehrenbergi represents an important but underexplored area of research that may reveal species-specific adaptations in serotonergic signaling:

Known Adapter Protein Interactions:
Studies in other species have identified critical adapter proteins that modulate 5-HT1B receptor function, particularly p11 (S100A10), which affects receptor trafficking and signaling . In standard mouse models, p11 knockout alters 5-HT1B receptor function, leading to reduced long-term emotional memory performance. Interestingly, 5-HT1B receptor agonist treatment enhances memory in p11 knockout mice but impairs it in wild-type mice .

Comparative Interaction Hypothesis:
Given Spalax ehrenbergi's unique evolutionary adaptations, HTR1B-adapter protein interactions may show species-specific characteristics:

SpeciesHTR1B-p11 InteractionFunctional ConsequenceResearch Approach
Laboratory MouseWell-documentedBidirectional regulation of emotional memoryEstablished knockout models
Spalax ehrenbergiUnknown, potentially modifiedMay influence adaptation to solitary lifestyle and territorial behaviorRequires development of species-specific tools
HumanClinical relevance in depressionTherapeutic target for cognitive impairmentsClinical and translational studies

Recommended Methodological Approaches:

  • Co-immunoprecipitation studies to identify Spalax-specific HTR1B interaction partners

  • Yeast two-hybrid screening to discover novel adapter proteins

  • Protein-protein interaction mapping using proximity labeling approaches

  • Functional analysis of identified interactions using receptor trafficking assays

Understanding these interactions could provide crucial insights into how the serotonergic system has adapted in this species to support its extraordinary neuroethological traits .

What are common challenges in expressing and purifying recombinant Spalax ehrenbergi HTR1B, and how can they be addressed?

Researchers working with recombinant Spalax ehrenbergi HTR1B commonly encounter several technical challenges:

Expression Challenges:

  • Low expression yields due to membrane protein characteristics

  • Protein misfolding in bacterial expression systems

  • Inconsistent post-translational modifications

Purification Challenges:

  • Detergent sensitivity affecting protein stability

  • Co-purification of bacterial contaminants

  • Maintaining receptor functionality during purification

Recommended Solutions:

ChallengeTechnical SolutionMethodological Notes
Low expression yieldOptimize codon usage for expression systemConsider species-specific rare codons in the Spalax sequence
Protein misfoldingUse specialized E. coli strains (e.g., Rosetta-gami)These strains enhance disulfide bond formation
Detergent sensitivityTest detergent screen (DDM, LMNG, CHS combinations)Begin with milder detergents at lowest effective concentration
Bacterial contaminantsMulti-step purification (IMAC followed by SEC)Include wash steps with low imidazole concentrations
Functionality preservationReconstitute in lipid nanodiscs or proteoliposomesMimics native membrane environment

Researchers should verify protein quality using SDS-PAGE to confirm >85% purity and employ binding assays with known ligands to assess functional integrity of the purified receptor.

How can researchers optimize experimental conditions when studying HTR1B function in the context of Spalax ehrenbergi's adaptation to hypoxia?

Optimizing experimental conditions for studying HTR1B function in the context of hypoxia adaptation requires careful consideration of environmental parameters:

Oxygen Tension Control:

  • Establish a gradient of oxygen concentrations (21% down to 3-6%) mimicking Spalax's natural environment

  • Implement precise oxygen monitoring throughout experiments

  • Account for temporal adaptation by testing acute versus chronic hypoxia exposure

Temperature Considerations:

  • Conduct experiments at both standard laboratory temperature (37°C) and at temperatures mimicking underground burrows (typically 30-32°C)

  • Control for temperature fluctuations during hypoxic conditions

pH Management:

  • Monitor and control pH changes that occur during hypoxic conditions

  • Include buffering system optimization to maintain physiological relevance

Experimental Design Recommendations:

  • Incorporate paired normoxic controls for all hypoxic experiments

  • Design time-course experiments to capture dynamic receptor adaptation

  • Consider tissue-specific differences in HTR1B response to hypoxia

  • Include comparative experiments with HTR1B from non-hypoxia-adapted species

These optimizations will help reveal how HTR1B function in Spalax ehrenbergi contributes to the species' extraordinary tolerance to hypoxic conditions, building upon insights from their erythropoietin receptor adaptations .

What are promising research avenues for understanding the role of HTR1B in Spalax ehrenbergi's unique solitary behavior?

Future research on HTR1B's role in Spalax ehrenbergi's solitary behavior should focus on several promising directions:

Comparative Neurobiology Approaches:

  • Cross-species receptor profiling between Spalax ehrenbergi and social rodents (mice, voles)

  • Analysis of HTR1B distribution in brain circuits governing social behavior and aggression

  • Identification of species-specific differences in HTR1B signaling cascades

Neuroethological Studies:

  • Integration of HTR1B pharmacological manipulation with naturalistic behavioral assessments

  • Investigation of seasonality and reproductive state effects on HTR1B function

  • Exploration of sensory system adaptations and their relationship to HTR1B signaling

The blind mole rat presents an ideal neuroethological model for studying aggressive and solitary behaviors . Future studies should leverage their "anti-social" behavioral phenotype to understand how serotonergic signaling through HTR1B contributes to the neural basis of sociality and its evolutionary adaptations.

How might findings from Spalax ehrenbergi HTR1B research translate to understanding human neuropsychiatric conditions?

Research on Spalax ehrenbergi HTR1B has significant translational potential for understanding human neuropsychiatric conditions:

Relevant Human Conditions:

  • Depression and anxiety disorders involving serotonergic dysfunction

  • Social behavior disorders with altered territoriality or aggression

  • Adaptations to environmental stressors, particularly hypoxia-related conditions

Translational Pathways:

Spalax HTR1B FeatureHuman Health RelevancePotential Applications
Adaptation to solitary lifestyleSocial withdrawal in psychiatric disordersNovel therapeutic targets for social dysfunction
HTR1B modulation under hypoxic stressHypoxia-related brain pathologies (stroke, altitude sickness)Neuroprotective strategies
Interaction with adapter proteinsDepression-associated changes in p11-HTR1B function Biomarkers for treatment response

By understanding the molecular adaptations of HTR1B in this extreme specialist species, researchers may identify novel mechanisms of serotonergic plasticity relevant to human health conditions where social behavior and stress adaptation are compromised.

What emerging technologies could advance the study of Spalax ehrenbergi HTR1B structure and function?

Several cutting-edge technologies hold particular promise for advancing Spalax ehrenbergi HTR1B research:

Structural Biology Approaches:

  • Cryo-electron microscopy for high-resolution receptor structure determination

  • Single-particle analysis to capture different conformational states

  • Hydrogen-deuterium exchange mass spectrometry to map ligand-binding dynamics

Advanced Genetic Tools:

  • CRISPR-Cas9 gene editing optimized for Spalax ehrenbergi cells

  • Development of Spalax-derived cell lines for native receptor expression

  • Species-specific induced pluripotent stem cells for neuronal differentiation studies

Novel Imaging Technologies:

  • Photopharmacology with light-controlled receptor ligands

  • Genetically encoded sensors for HTR1B activation

  • In vivo calcium imaging in freely behaving animals

Computational Approaches:

  • Molecular dynamics simulations of species-specific receptor-ligand interactions

  • AI-driven prediction of adapter protein binding sites

  • Systems biology modeling of serotonergic networks in social versus solitary species

These emerging technologies will enable researchers to probe the unique adaptations of Spalax ehrenbergi HTR1B with unprecedented precision, advancing our understanding of how serotonergic systems evolve in response to specialized ecological niches and behavioral adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.