Recombinant Sparus aurata Rhodopsin (rho)

What is Recombinant Sparus aurata Rhodopsin (rho) and how is it produced in laboratory settings?

Recombinant Sparus aurata Rhodopsin (rho) is the artificially produced version of the photoreceptor protein found in gilthead sea bream (Sparus aurata). This G protein-coupled receptor (GPCR) plays a crucial role in the visual system by detecting light through its interaction with retinal chromophore.

The production process typically involves:

• Gene cloning into an appropriate expression vector with epitope tags (such as Rho1D4)

• Expression in various systems including:

  • E. coli bacterial system

  • Yeast expression systems

  • Baculovirus expression systems

• Protein purification via affinity chromatography using Rho1D4-conjugated agarose columns

• Reconstitution with 11-cis retinal (for functional studies)

• Quality control assessment through SDS-PAGE and spectroscopic methods

For optimal purification, cell membranes are typically solubilized with 1% dodecyl maltoside (DDM) in buffer (50 mM HEPES, 140 mM NaCl, pH 6.5), adsorbed to antibody columns, washed with 0.02% DDM, and eluted using synthetic peptides corresponding to the epitope sequence .

What structural features characterize Sparus aurata Rhodopsin?

Sparus aurata Rhodopsin shares key structural features with other vertebrate rhodopsins:

• Primary structure consisting of 353 amino acids with sequence beginning "MNGTEGPFFYVPMVNTSGIVRSPYEYPQYYLVNPAAYAALGAYMFLLILVGFPINFLTLY..."

• Seven transmembrane (TM) helical domains characteristic of GPCRs, connected by alternating intracellular and extracellular loops

• A binding pocket for 11-cis retinal chromophore, which forms a Schiff base linkage with a conserved lysine residue

• G-protein interaction sites in the intracellular domains, particularly the third intracellular loop and C-terminal region, for interaction with transducin

• Disulfide bond between extracellular loops that stabilizes tertiary structure

• Post-translational modifications that may vary depending on the expression system used

The three-dimensional structure is expected to resemble other vertebrate rhodopsins for which crystal structures are available, with the seven TM helices arranged in a characteristic bundle formation .

How does Rhodopsin function in the visual system of Sparus aurata?

Rhodopsin functions through a light-activated signaling cascade in the visual system of Sparus aurata:

• In darkness, rhodopsin contains 11-cis retinal covalently bound to the protein

• Light absorption triggers isomerization of 11-cis retinal to all-trans retinal

• This isomerization induces conformational changes in the protein structure, converting rhodopsin to its active state (metarhodopsin II or Meta II)

• Activated rhodopsin interacts with and activates the G-protein transducin

• Activated transducin stimulates phosphodiesterase (PDE), which hydrolyzes cyclic GMP (cGMP) to GMP

• Reduced cGMP levels cause closure of cGMP-gated channels in the photoreceptor membrane

• Channel closure results in membrane hyperpolarization and altered neurotransmitter release

Research has established that dietary factors, particularly docosahexaenoic acid (DHA), significantly influence rhodopsin expression and photoreceptor abundance in Sparus aurata larvae, with direct implications for visual development and feeding success .

What experimental techniques are commonly used to study Recombinant Sparus aurata Rhodopsin?

A diverse array of techniques is employed to investigate different aspects of Recombinant Sparus aurata Rhodopsin:

Spectroscopic Methods:

• UV-Visible Spectroscopy: Measures absorption spectra and determines λmax of rhodopsin-retinal complexes

• Infrared Spectroscopy: Monitors conformational changes during activation

• Circular Dichroism: Assesses protein secondary structure

Molecular Biology Techniques:

• Site-Directed Mutagenesis: Creates specific mutations to study structure-function relationships

• Heterologous Expression: Produces protein in various systems (E. coli, yeast, mammalian cells)

Protein Biochemistry:

• SDS-PAGE: Assesses protein purity and molecular weight

• Affinity Chromatography: Purifies protein using Rho1D4 antibody columns

Functional Assays:

• G-protein Activation Assays: Measures ability to activate G-proteins

• cAMP Assays: Assesses downstream signaling events using GloSensor cAMP assay

• Retinal Binding Assays: Studies interaction with retinal isomers

Structural Biology:

• X-ray Crystallography: Provides high-resolution structural determination

• Molecular Dynamics Simulations: Studies protein dynamics and conformational changes

Cellular and Tissue Analysis:

• In Situ Hybridization: Examines gene expression patterns in tissues

• Immunocytochemistry: Localizes protein within cells or tissues

• Microscopy: Including electron microscopy for ultrastructural studies

What approaches can be used to study the interaction between Sparus aurata Rhodopsin and G proteins?

Investigating rhodopsin-G protein interactions requires specialized methodologies:

Functional Assays:

• GTPγS Binding Assay: Measures exchange of GDP for non-hydrolyzable GTP analog on G protein α subunit

• GloSensor cAMP Assay: Monitors intracellular cAMP levels as downstream consequence of G protein activation

• FRET/BRET-based Assays: Detects real-time protein-protein interactions

Biochemical Approaches:

• Co-immunoprecipitation: Isolates rhodopsin-G protein complexes

• Cross-linking: Chemically links interacting proteins for identification of contact sites

• Pull-down Assays: Uses tagged proteins to isolate complexes

Structural Biology:

• X-ray Crystallography or Cryo-electron Microscopy: Visualizes the complex structure

• Molecular Dynamics Simulations: Models interaction interfaces

Mutational Analysis:

• Site-directed Mutagenesis: Particularly of intracellular loops and C-terminal region

• Analysis of the "Ionic Lock": Feature constraining rhodopsin in inactive conformation

Peptide-based Approaches:

• Synthetic Peptide Competition: Uses peptides corresponding to specific regions of rhodopsin or G proteins

Native Membrane Studies:

• Native Mass Spectrometry: Probes signaling cascade across native membrane fragments

• Reconstitution Systems: Incorporates purified components into lipid vesicles

These complementary approaches provide insights into the kinetics, specificity, and structural basis of rhodopsin-G protein interactions fundamental to visual signal transduction.

How do the spectral properties of Sparus aurata Rhodopsin compare to rhodopsins from other species?

Comparative analysis of rhodopsin spectral properties reveals evolutionary adaptations for different light environments:

Absorption Maximum (λmax):

• Sparus aurata Rhodopsin, like most vertebrate rhodopsins, typically exhibits a λmax around 500 nm, corresponding to the blue-green spectrum region optimal for aquatic environments

• Teleost fish rhodopsins (including those from intron-less and intron-containing genes) generally maintain this ~500 nm λmax

Spectral Tuning Mechanisms:

• Specific amino acid substitutions can shift λmax, as demonstrated in Japanese eel deep-sea rhodopsin, where D83N/A292S mutations cause a blue-shift to 483 nm

• These shifts represent adaptations to different aquatic light environments—deep-water species often have blue-shifted rhodopsins to detect predominant blue wavelengths at depth

Photoproduct Formation:

• The formation and decay kinetics of photointermediates vary between species

• Mutations can affect intermediate lifetimes, as with the P194L mutation in Atlantic tarpon exo-rhodopsin that slightly prolongs meta II intermediate lifetime

Regeneration Properties:

• Regeneration capabilities differ between species and can be modified through mutations

• The G188C mutation in bovine rhodopsin creates photocyclic properties, allowing reversion to the dark state through both thermal reaction and photoreaction

To conduct these comparative analyses, researchers typically express recombinant rhodopsins from different species, reconstitute with 11-cis retinal, and measure absorption spectra using UV-visible spectroscopy, often employing site-directed mutagenesis to identify residues responsible for spectral differences.

How does dietary docosahexaenoic acid (DHA) influence rhodopsin expression and photoreceptor abundance in Sparus aurata larvae?

Dietary docosahexaenoic acid (DHA; 22:6n-3) significantly impacts rhodopsin expression and photoreceptor development in gilthead sea bream larvae:

Research Findings:

• Dose-Dependent Relationship: A significant prey DHA dose-dependent effect on rhodopsin gene expression has been established (P<0.05)

• Developmental Progression: Rhodopsin expression increases significantly with both dietary DHA level and larval age (P<0.0001)

• Photoreceptor Abundance: A significant (P<0.005) prey DHA dose-dependent effect on photoreceptor cell abundance in 34 DPH larval retina has been documented

Mechanisms and Functional Impacts:

• DHA promotes faster conformational changes in light-stimulated rhodopsin, accelerating visual stimulus processing

• Enhanced photoreceptor abundance and rhodopsin expression lead to improved vision

• Improved visual function translates to more efficient prey detection and capture

• Larval dry weight shows marked (P<0.05) enhancement with dietary DHA inclusion

Experimental Approaches:

This research establishes a clear link between dietary DHA, rhodopsin expression, photoreceptor development, and fish performance, highlighting this fatty acid's critical role in Sparus aurata visual development.

How can site-directed mutagenesis be applied to study the structure-function relationship of Sparus aurata Rhodopsin?

Site-directed mutagenesis provides powerful insights into rhodopsin structure-function relationships:

Experimental Design:

• Target Selection: Residues are chosen based on sequence conservation, structural position, or hypothesized function

• Mutation Construction: Techniques like seamless ligation cloning extract (SLiCE) or In-Fusion cloning introduce precise mutations

• Comparative Analysis: Results are compared with similar mutations in rhodopsins from other species

Key Target Regions:

• Retinal Binding Pocket: Mutations affect spectral tuning and activation mechanisms

• G-protein Interaction Sites: Mutations in cytoplasmic loops impact signal transduction

• Transmembrane Helices: Mutations in conserved residues affect protein stability

• Strategic Positions: Position 188 (G188C in bovine rhodopsin) creates photocyclic properties

Functional Characterization:

• Spectroscopic Analysis: Absorption spectra determine λmax and photointermediate formation

• Chromophore Binding: Assessment of 11-cis and all-trans retinal binding capabilities

• Photocycle Kinetics: Measurements of photointermediate formation/decay rates

• G-protein Activation: Quantification using assays like GloSensor cAMP

Specific Examples:

• Position 188 Mutations: G188C in bovine rhodopsin creates a unique active state that can revert to the original dark state through both thermal reaction and photoreaction

• Positions 83/292: D83N/A292S mutations in Japanese eel rhodopsin cause a blue-shift in absorption maximum

• Position 194: P194L mutation in Atlantic tarpon exo-rhodopsin prolongs meta II intermediate lifetime

Applications:

• Optogenetic Tool Development: Certain mutations provide advantages for developing optogenetic tools

• Disease Mechanism Understanding: Findings correlate with rhodopsin mutations in retinal diseases

How can Sparus aurata Rhodopsin be used as a model for studying retinal degeneration diseases?

Sparus aurata Rhodopsin serves as a valuable model for investigating retinal degeneration mechanisms:

Comparative Mutation Analysis:

• Human retinitis pigmentosa (RP) mutations can be introduced into recombinant Sparus aurata Rhodopsin

• Mutations like Y102H, I307N, and G90V affect the inactive-active equilibrium of the receptor, reducing inactive conformation stability while increasing active conformation stability

Protein Misfolding and Trafficking Studies:

• Many rhodopsin mutations in RP cause protein misfolding and trafficking defects

• Studies in transgenic models show mutant rhodopsin (e.g., Ser334ter) at inappropriately high levels in plasma membrane and cytoplasm

• Similar phenomena can be investigated in Sparus aurata Rhodopsin to elucidate disease mechanisms

Experimental Systems:

• Cell Culture Models: Express wild-type and mutant rhodopsins to study folding, trafficking, and stability

• Biochemical Characterization: Compare structural and functional properties between wild-type and mutant forms

Constitutive Activation Analysis:

• Some RP mutations cause constitutive phototransduction cascade activation

• Dark-rearing experiments help determine whether degeneration depends on light exposure

• Similar approaches with Sparus aurata Rhodopsin can clarify activation-dependent degeneration mechanisms

Therapeutic Strategy Testing:

• Pharmacological Chaperones: Test compounds that might stabilize mutant rhodopsin

• Gene Therapy Approaches: Evaluate strategies for delivering wild-type rhodopsin

• Neuroprotective Agents: Assess compounds that might slow photoreceptor death

Methodological Approaches:

• Site-Directed Mutagenesis: Introduces disease-causing mutations

• Spectroscopic Analysis: Assesses mutation impact on stability and function

• Cellular Localization Studies: Determines protein trafficking patterns

• G-protein Activation Assays: Measures signaling capabilities of mutant rhodopsins

This approach advances understanding of molecular mechanisms underlying retinal degeneration and provides a platform for testing potential therapeutic interventions.

What are the optimal conditions for reconstitution of Recombinant Sparus aurata Rhodopsin with retinal?

Successful reconstitution of functional Recombinant Sparus aurata Rhodopsin requires careful attention to experimental conditions:

Retinal Isomer Selection:

• 11-cis retinal is standard for reconstituting native dark-state rhodopsin

• All-trans retinal can be used for specific experimental purposes

• G188C mutant (of bovine rhodopsin) reconstituted with all-trans retinal can form photopigments with predominantly 11-cis and 9-cis retinals

Reconstitution Protocol:

• Cell Membrane Preparation: Cells are collected by centrifugation and suspended in buffer (50 mM HEPES, 140 mM NaCl, 3 mM MgCl₂, pH 6.5)

• Retinal Addition: Added to cell suspension under dark conditions

• Incubation Conditions: Optimal reconstitution with 11-cis retinal requires 4°C incubation for 24h in darkness

• Detergent Solubilization: Membranes are solubilized using 1% dodecyl maltoside (DDM)

Buffer Composition:

• HEPES-based buffers (50 mM HEPES, 140 mM NaCl, pH 6.5)

• Slightly acidic pH (6.5) maintains rhodopsin stability

• Additional components may include MgCl₂ (3 mM)

Purification Process:

• Affinity Chromatography: Rho1D4 antibody columns for appropriately tagged proteins

• Washing: Buffer containing low detergent concentration (0.02% DDM)

• Elution: Same buffer with synthetic peptide corresponding to epitope sequence

Verification Methods:

• Absorption Spectroscopy: Confirms properly folded photopigment presence

• λmax Verification: Should be approximately 500 nm for Sparus aurata Rhodopsin

• Light Exposure Testing: Observes characteristic spectral shifts

Storage Conditions:

• Temperature: -20°C/-80°C for extended storage

• Glycerol Addition: 5-50% glycerol improves freezing stability

• Aliquoting: Prevents protein degradation from repeated freeze-thaw cycles

• Short-term Storage: 4°C for up to one week

These optimized conditions ensure production of functional recombinant protein suitable for various experimental applications in vision research.

What methods can be used to assess the stability and functionality of Recombinant Sparus aurata Rhodopsin in different experimental conditions?

Comprehensive assessment of rhodopsin stability and functionality requires multiple complementary methods:

Thermal Stability Assessment:

• Differential Scanning Calorimetry (DSC): Measures heat capacity changes during unfolding

• Spectroscopic Thermal Denaturation: Tracks absorption, fluorescence, or circular dichroism changes during controlled temperature increases

• Temperature-dependent stability is critical for storage and experimental design

Spectroscopic Functional Analysis:

• UV-Visible Absorption Spectroscopy: Monitors characteristic ~500 nm absorption peak of properly folded rhodopsin

• Light-induced Spectral Shifts: Observes absorption spectrum changes upon light exposure

• Time-resolved Spectroscopy: Measures photointermediate formation/decay kinetics

Chromophore Binding Analysis:

• Retinal Binding Assays: Quantifies ability to bind retinal isomers

• HPLC Analysis: Determines bound retinal isomeric composition

• Regeneration Studies: Assesses opsin's ability to regenerate with fresh retinal after bleaching

Signal Transduction Assessment:

• G-protein Activation Assays: Measures ability to activate transducin

• GTPγS Binding: Quantifies G protein α subunit nucleotide exchange

• cAMP Assays: Measures downstream signaling using GloSensor system

Structural Integrity Evaluation:

• Limited Proteolysis: Properly folded proteins show different protease susceptibility

• Antibody Binding: Conformation-specific antibodies distinguish different protein states

• SDS-PAGE and Western Blotting: Assess protein integrity and degradation

Storage Stability Studies:

• Time-course Analysis: Monitors stability over time under different conditions

• Freeze-thaw Stability: Assesses freeze-thaw cycle impact

• Buffer Component Effects: Tests different buffer compositions, pH values, and additives

Environmental Condition Tests:

• pH Stability Profile: Tests functionality across different pH values

• Salt Concentration Effects: Examines ionic strength impact

• Detergent Compatibility: Compares stability in different detergent types/concentrations

These methods provide a comprehensive assessment of rhodopsin stability and functionality, ensuring reliable research outcomes across experimental conditions.