Recombinant Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mdtI; YPO2069; y2241; YP_1912; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Yersinia pestis
Target Names
mdtI
Target Protein Sequence
MQQLEFYPIAFLILAVMLEIVANILLKMSDGFRRKWLGILSLLSVLGAFSALAQAVKGIE LSVAYALWGGFGIAATVAAGWILFNQRLNYKGWIGLILLLAGMVMIKLS
Uniprot No.

Target Background

Function

Function: Catalyzes the excretion of spermidine.

Database Links

KEGG: ype:YPO2069

STRING: 187410.y2241

Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Spermidine export protein MdtI and what is its relationship with MdtJ?

MdtI is a protein that functions as part of the MdtJI complex, which catalyzes the excretion of spermidine from cells. Both MdtI and MdtJ belong to the small multidrug resistance (SMR) family of drug exporters. Importantly, neither MdtI nor MdtJ alone is sufficient for spermidine excretion activity; both proteins must be present to form a functional complex .

How should I design experiments to identify MdtI as a spermidine exporter?

To identify and confirm MdtI as a spermidine exporter, a comprehensive experimental approach similar to that used by Higashi et al. (2007) is recommended:

  • Cell viability assays: Transform a spermidine acetyltransferase-deficient strain (e.g., E. coli CAG2242) with candidate genes and measure cell viability in the presence of toxic levels of spermidine (e.g., 2 mM) .

  • Growth recovery experiments: Measure cell growth recovery in the presence of high spermidine concentrations (e.g., 12 mM) when genes of interest are expressed .

  • Intracellular polyamine measurements: Quantify spermidine and putrescine content in cells cultured with or without exogenous spermidine, comparing control cells with those expressing the candidate exporter .

  • Direct excretion measurements: Measure the excretion of accumulated [14C]spermidine from cells and quantify the level of spermidine in the reaction mixture after removing cells by centrifugation .

This multi-faceted approach provides robust evidence for spermidine export activity.

What expression systems are recommended for recombinant MdtI production?

For recombinant MdtI production, several expression systems can be employed depending on research needs:

  • E. coli expression system: Provides high yields and shorter turnaround times. This system is particularly suitable for basic structural studies and when post-translational modifications are not critical .

  • Yeast expression system: Offers good yields with some eukaryotic post-translational modifications, useful for functional studies requiring more native-like protein processing .

  • Insect cells with baculovirus: Provides many post-translational modifications necessary for correct protein folding, suitable for advanced functional studies .

  • Mammalian cell expression: Offers the most complete post-translational modifications, ideal for studies requiring fully native protein activity .

When expressing MdtI, it is common to include affinity tags such as His-tag for purification purposes. The plasmid pCA24N-mdtI with an IPTG-inducible promoter (pT5/lac) and a His tag at the NH2 terminus has been successfully used for MdtI expression .

How can site-directed mutagenesis be employed to study MdtI function?

Site-directed mutagenesis is a powerful approach to investigate the functional importance of specific amino acid residues in MdtI:

  • Plasmid preparation: Start with a plasmid encoding both MdtJ and MdtI in an operon (e.g., pUC mdtJI) .

  • Mutagenesis techniques: Use overlap extension PCR or a QuikChange site-directed mutagenesis kit according to the manufacturer's protocol .

  • Target residue selection: Based on previous research, focus on acidic and aromatic residues in MdtI, particularly Glu5, Glu19, Asp60, Trp68, and Trp81, which have been implicated in spermidine export activity .

  • Functional validation: Assess the impact of mutations by expressing the mutant proteins and measuring spermidine excretion activity, cell viability in the presence of spermidine, and growth recovery .

  • Sequence confirmation: Confirm all mutations using DNA sequencing techniques, such as with a CEQ8000 DNA genetic analysis system .

This methodical approach allows for precise determination of structure-function relationships in MdtI.

What techniques can be used to study MdtI-spermidine binding interactions?

Several sophisticated techniques can be employed to study the binding interaction between MdtI and spermidine:

  • Near-UV synchrotron radiation circular dichroism spectroscopy: This highly sensitive technique can detect conformational changes in MdtI upon spermidine binding. Measurements can be performed with protein (20-40 μM) in appropriate buffer conditions, with titrations of spermidine (0-10 mM) .

  • Multiple Reaction Monitoring (MRM): MRM can be used for selective quantification of compounds within complex mixtures, including spermidine binding to MdtI. This technique provides high sensitivity and specificity, allowing for detection at femtomole concentrations .

  • Intact mass analysis: For studying the direct binding of spermidine to MdtI, intact mass analysis by mass spectrometry can be employed, with LC-MS being suitable for proteins >6,000 amu like MdtI .

When conducting binding studies, it's important to include appropriate controls, such as testing binding of related polyamines (e.g., spermine) to assess specificity .

How should spermidine export kinetics data be analyzed?

Analysis of spermidine export kinetics requires rigorous quantitative approaches:

  • Time-course measurements: Collect data on spermidine excretion at multiple time points (e.g., 0, 10, 20, 30, 40 minutes) to capture the kinetics of the process .

  • Quantification methods: Use sensitive quantification methods such as measuring radioactively labeled ([14C]) spermidine or high-performance liquid chromatography (HPLC) to detect spermidine levels inside cells and in the extracellular medium .

  • Kinetic parameter determination: Calculate initial rates of spermidine export at different substrate concentrations to determine parameters such as Km and Vmax values.

  • Michaelis-Menten analysis: For binding studies, fit the change in mean residue ellipticity ([θ]MRE) at different spermidine concentrations to the Michaelis-Menten equation using software such as GraphPad Prism to determine apparent dissociation constants .

  • Statistical validation: Apply appropriate statistical tests to validate the significance of observed differences in export rates between wild-type and mutant proteins or between different experimental conditions.

This comprehensive analysis provides robust quantitative insights into the kinetics and efficiency of spermidine export by MdtI.

How can molecular dynamics simulations inform MdtI research?

Molecular dynamics (MD) simulations offer powerful computational approaches to study MdtI function:

  • Structure prediction and validation: In the absence of crystal structures, MD can help refine homology models of MdtI based on related transporters .

  • Conformational dynamics: MD simulations can reveal the dynamic behavior of MdtI, including conformational changes during the transport cycle .

  • Protein-substrate interactions: Simulations can identify key interactions between MdtI and spermidine, complementing experimental mutagenesis studies .

  • Transport mechanism elucidation: MD can help elucidate the molecular mechanism of spermidine transport, including potential energy barriers and conformational changes .

  • Rational design of experiments: Insights from MD can guide the design of experiments, such as suggesting specific residues for mutagenesis or predicting the effects of mutations .

What methods are effective for studying the MdtJI complex formation?

To study the formation and function of the MdtJI complex, several approaches can be employed:

  • Co-expression systems: Develop systems for co-expressing MdtJ and MdtI, such as pUC mdtJI or pMW mdtJI, which encode both proteins in an operon under their natural promoter .

  • Tagged protein constructs: Create constructs with different tags for each protein, such as pUC mdtJ-HA3 for MdtJ and pCA24N-mdtI with a His tag for MdtI, to facilitate co-purification and detection .

  • Pull-down assays: Use the differentially tagged proteins to perform pull-down assays to confirm direct interaction between MdtJ and MdtI.

  • Functional complementation: Test the ability of separately expressed MdtJ and MdtI to restore spermidine export function in appropriate mutant strains .

  • In vivo crosslinking: Apply crosslinking approaches to capture the MdtJI complex in its native membrane environment.

These methods provide complementary approaches to understand the formation, stoichiometry, and functional importance of the MdtJI complex.

How can I measure the impact of spermidine on MdtJI expression?

To investigate how spermidine affects the expression of the MdtJI complex:

  • mRNA level analysis: Use real-time quantitative PCR (RT-qPCR) to measure changes in mdtJI mRNA levels in response to different concentrations of spermidine .

  • Promoter activity assays: Create reporter constructs fusing the mdtJI promoter to reporter genes such as luciferase or GFP to measure promoter activity in response to spermidine.

  • Protein level quantification: Use Western blotting with antibodies against MdtJ and MdtI, or against their respective tags if using tagged constructs, to measure protein levels after spermidine treatment.

  • Dose-response and time-course studies: Perform dose-response experiments with different spermidine concentrations and time-course studies to determine the optimal conditions for induction.

  • Comparative analysis: Compare the expression of MdtJI in wild-type cells versus cells deficient in spermidine acetyltransferase to understand the relationship between spermidine accumulation and MdtJI expression .

These approaches provide a comprehensive understanding of how spermidine regulates the expression of its own export system.

How should contradictory results in MdtI function studies be approached?

When encountering contradictory results in MdtI research:

  • Experimental conditions comparison: Carefully analyze differences in experimental conditions, including:

    • E. coli strains used (wild-type vs. spermidine acetyltransferase-deficient)

    • Expression systems and vectors (high-copy vs. low-copy)

    • Spermidine concentrations (e.g., 2 mM vs. 12 mM)

    • Growth conditions (media composition, pH, temperature)

  • Functional redundancy assessment: Consider the possibility of functional redundancy with other transporters that might mask MdtI function in certain conditions.

  • Technical validation: Validate key findings using multiple technical approaches:

    • Direct measurement of spermidine export

    • Intracellular spermidine quantification

    • Cell viability assays

    • Growth recovery experiments

  • Molecular interaction studies: Investigate the molecular details of MdtI function using techniques like site-directed mutagenesis to resolve mechanistic contradictions .

  • Literature review and expert consultation: Conduct a thorough literature review and consult with experts in the field to contextualize and interpret contradictory findings.

This systematic approach helps resolve contradictions and develop a more complete understanding of MdtI function.

How can I apply protein design principles to study MdtI structure-function relationships?

Advanced protein design approaches can yield valuable insights into MdtI structure-function relationships:

  • Computational protein design: Use computational methods to design MdtI variants with altered properties:

    • Stability engineering through rigidification of flexible sites

    • Modulation of substrate specificity

    • Enhancement of export activity

  • Molecular dynamics (MD) simulations: Employ MD to:

    • Identify conformational states relevant to function

    • Reveal transitions between these conformations

    • Understand protein dynamics at atomic resolution

  • Rational design based on homology: Draw insights from thermophilic homologs to design MdtI variants with enhanced stability:

    • Identify stabilizing interactions in homologous proteins

    • Introduce salt bridges and polar interactions

    • Optimize hydrophobic core packing

  • Experimental validation: Validate computational predictions through:

    • Site-directed mutagenesis of predicted key residues

    • Functional assays measuring spermidine export

    • Structural characterization of designed variants

  • Iterative design-test cycles: Implement an iterative approach where experimental results inform subsequent computational designs, creating a feedback loop that progressively enhances understanding .

This integrated computational-experimental approach provides deep insights into the relationship between MdtI structure and function.

What techniques can determine the essential residues for MdtI function?

To identify and characterize essential residues for MdtI function:

  • Alanine scanning mutagenesis: Systematically replace individual residues with alanine to identify those critical for function, focusing particularly on charged and aromatic residues .

  • Conservation analysis: Perform multiple sequence alignment of MdtI homologs to identify evolutionarily conserved residues likely to be functionally important.

  • Structure-guided mutagenesis: Based on structural models or homology to related transporters, target residues predicted to line the transport pathway or be involved in substrate binding.

  • Charge reversal and conservative substitutions: For charged residues (Glu5, Glu19, Asp60), perform both charge reversal (e.g., E to K) and conservative substitutions (e.g., E to D) to distinguish between charge-dependent and structure-dependent effects .

  • Functional assessment: Evaluate the impact of mutations using:

    • Cell viability assays in the presence of spermidine

    • Direct measurement of spermidine export

    • Protein expression and localization analysis to ensure proper folding and membrane insertion

Previous research has identified several key residues in MdtI, including Glu5, Glu19, Asp60, Trp68, and Trp81, providing a foundation for further structural and functional studies .

How can understanding MdtI function contribute to broader research fields?

Research on MdtI has implications for several broader scientific fields:

  • Polyamine metabolism regulation: Understanding spermidine export by MdtI provides insights into how cells regulate polyamine homeostasis, which is critical for normal cell growth and function .

  • Drug resistance mechanisms: As a member of the SMR family of drug exporters, insights from MdtI can inform our understanding of multidrug resistance mechanisms in bacteria .

  • Membrane transport biology: The MdtJI complex serves as a model system for studying how small membrane proteins form functional complexes to perform transport functions .

  • Synthetic biology applications: Engineered MdtI variants could be used in synthetic biology applications, such as creating cells with altered polyamine metabolism or developing biosensors for polyamines.

  • Antimicrobial development: Understanding bacterial polyamine export systems may contribute to the development of novel antimicrobial strategies targeting polyamine homeostasis.

These connections highlight the broader impact of MdtI research beyond its specific function in spermidine export.

What are the cutting-edge research directions for MdtI studies?

Emerging research directions for MdtI include:

  • Structural determination: Using advanced structural biology techniques such as cryo-electron microscopy to determine the high-resolution structure of the MdtJI complex in different conformational states.

  • Single-molecule studies: Applying single-molecule techniques to observe the transport cycle of individual MdtJI complexes in real-time.

  • Systems biology integration: Investigating how MdtI-mediated spermidine export integrates with broader cellular processes, including polyamine metabolism, stress responses, and growth regulation.

  • Computational protein design: Using advanced computational methods to design MdtI variants with altered substrate specificity, enhanced activity, or novel functions .

  • Regulation network elucidation: Mapping the complete regulatory network controlling MdtJI expression, including transcription factors, small RNAs, and metabolic signals.

  • Comparative genomics: Exploring the evolution and distribution of MdtI homologs across different bacterial species to understand its evolutionary history and functional diversification.

These cutting-edge directions represent exciting opportunities for advancing our understanding of MdtI function and its broader biological significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.