Recombinant Spermidine/putrescine transport system permease protein PotC (potC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please specify it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
potC; c1399; Spermidine/putrescine transport system permease protein PotC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Target Names
potC
Target Protein Sequence
MIGRLLRGGFMTAIYAYLYIPIIILIVNSFNSSRFGINWQGFTTKWYSLLMNNDSLLQAA QHSLTMAVFSATFATLIGSLTAVALYRYRFRGKPFVSGMLFVVMMSPDIVMAISLLVLFM LLGIQLGFWSLLFSHITFCLPFVVVTVYSRLKGFDVRMLEAAKDLGASEFTILRKIILPL AMPAVAAGWVLSFTLSMDDVVVSSFVTGPSYEILPLKIYSMVKVGVSPEVNALATILLVL SLVMVIASQLIARDKTKGNTGDVK
Uniprot No.

Target Background

Function
This protein is essential for the activity of the bacterial periplasmic transport system responsible for transporting putrescine and spermidine.
Database Links

KEGG: ecc:c1399

STRING: 199310.c1399

Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Spermidine/putrescine transport system permease protein PotC?

Spermidine/putrescine transport system permease protein PotC is a membrane protein component of the polyamine transport system found in various bacterial species, including Mycoplasma pneumoniae. It functions as part of a permease complex responsible for facilitating the transport of polyamines such as spermidine and putrescine across the cell membrane. PotC is specifically a transmembrane component of this ABC transporter system that works in conjunction with other proteins to enable polyamine uptake, which is essential for various cellular processes including growth, gene expression regulation, and stress response.

What experimental approaches are most effective for studying PotC function?

When investigating PotC function, researchers should implement a multi-faceted experimental design that combines both in vitro and in vivo approaches. Effective experimental designs typically include:

  • Expression system validation using controlled variable manipulation to establish cause-effect relationships between PotC expression and polyamine transport efficiency

  • Transport assays using radiolabeled or fluorescently tagged polyamines

  • Site-directed mutagenesis to identify critical functional domains

  • Protein-protein interaction studies to map the complete transport complex

These approaches should incorporate appropriate control groups to distinguish between PotC-specific effects and background transport activity. When designing such experiments, researchers must ensure that both dependent and independent variables are clearly defined, with the independent variable being the experimental manipulation of PotC and the dependent variable being the measured transport activity or other functional readouts .

How should researchers design experiments to study PotC protein folding and structure?

When investigating PotC folding and structure, researchers should consider the lessons learned from similar transmembrane proteins. Based on recombinant protein studies, it is critical to recognize that the presence of presequences may not prevent proper protein folding, although they can affect stability and conformation. As demonstrated with other recombinant proteins, denatured PotC can potentially be reactivated under specific conditions, achieving significant enzymatic activity compared to purified mature enzyme .

A comprehensive experimental protocol should include:

  • Purification in both native and denatured forms

  • Comparative analysis of refolding efficiency under various conditions

  • Sedimentation analysis to determine oligomeric state

  • Thermal stability assessments at various temperatures

When conducting such experiments, researchers should evaluate both enzymatic activity and structural integrity, recognizing that presequences may alter the compactness of protein structure without completely preventing functional folding .

What are the critical considerations for ensuring reproducibility in PotC characterization studies?

Ensuring reproducibility in PotC characterization requires rigorous attention to experimental design principles. Researchers must clearly distinguish between technical and biological replicates, understanding that technical replicates (repeated measurements of the same sample) cannot substitute for biological replicates (independent experimental units subjected to the same treatment) .

A robust experimental approach should:

  • Include sufficient biological replicates (minimum n=3) for statistical validity

  • Control for batch effects in protein preparation

  • Implement blinding procedures during data collection when possible

  • Pre-register experimental protocols and analysis plans

  • Document all experimental conditions comprehensively

Failure to address these considerations may lead to inability to replicate results, similar to cases where even Nobel laureates have had to retract papers due to irreproducibility issues . When analyzing PotC function, researchers should systematically identify and control potential confounding factors that could mask or mimic protein activity.

What are the optimal expression systems for recombinant PotC production?

Based on recombinant protein expression principles, researchers have several options for PotC expression, each with specific advantages:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, rapid growth, economicalPotential inclusion body formation, lack of post-translational modificationsInitial characterization, structural studies
Insect cellsBetter folding of membrane proteins, some post-translational modificationsHigher cost, longer production timeFunctional studies requiring proper membrane insertion
Mammalian cellsNative-like post-translational modificationsHighest cost, complex protocols, lower yieldStudies investigating host-pathogen interactions

When expressing recombinant PotC in E. coli, researchers should anticipate that approximately 5% of the total bacterial protein will be the target protein, with distribution in both soluble and insoluble fractions. Extraction from precipitate may require 8M urea or 6M guanidine HCl for solubilization , followed by controlled refolding protocols to restore function.

How can researchers address common challenges in purifying functional PotC?

Purification of functional PotC presents several challenges that can be addressed through methodological refinements:

  • Solubilization strategy: Optimize detergent type and concentration based on systematic screening

  • Refolding protocol: Implement step-wise dialysis with carefully controlled buffer transitions

  • Quality assessment: Apply multiple orthogonal techniques to verify structural integrity:

    • Enzymatic activity assays

    • Circular dichroism spectroscopy

    • Size exclusion chromatography

    • Thermostability assays

When refolding denatured PotC, researchers should expect approximately 15-20% recovery of specific activity compared to the native protein, with the process potentially requiring extended incubation periods (40-60 hours at 0°C) for optimal results .

How should researchers interpret discrepancies in PotC activity data between experiments?

When faced with discrepancies in PotC activity data, researchers should implement a systematic troubleshooting approach that distinguishes between methodological variations and true biological differences. Key considerations include:

  • Experimental variables assessment: Systematically evaluate buffer conditions, protein purity, and assay parameters

  • Statistical approach: Apply appropriate statistical tests that account for both biological and technical variance

  • Validation through orthogonal methods: Confirm findings using alternative techniques

  • Meta-analysis of published data: Compare results with literature values while accounting for methodological differences

It is critical to recognize that experimental artifacts can arise from improper replication strategies, such as treating technical replicates as biological replicates . When analyzing activity data, researchers should consider that recombinant PotC may display approximately 70-75% of the specific activity observed in the native protein context .

What controls are essential for validating PotC-substrate interaction studies?

Rigorous validation of PotC-substrate interactions requires comprehensive controls that address potential confounding factors:

  • Negative controls:

    • Heat-inactivated PotC preparations

    • Non-functional PotC mutants with targeted disruptions of binding sites

    • Non-substrate analogs with similar chemical properties

  • Positive controls:

    • Known high-affinity substrates

    • Concentration gradients to establish dose-dependency

    • Competitive binding with labeled and unlabeled substrates

  • Specificity controls:

    • Related transporters from the same family

    • Heterologous expression systems with and without PotC

Through careful implementation of these controls, researchers can distinguish between specific PotC-mediated transport and background membrane permeability or non-specific binding. This approach aligns with the fundamental principles of experimental research design, where the control group provides the essential basis for comparison to determine if changes in the dependent variable can be attributed to the manipulation of the independent variable .

What emerging technologies hold promise for advancing PotC research?

Several cutting-edge technologies are poised to transform PotC research:

  • Cryo-electron microscopy for high-resolution structural analysis

  • Native mass spectrometry for studying intact membrane protein complexes

  • Single-molecule tracking for real-time transport dynamics

  • CRISPR-based genetic screens for identifying functional partners

  • Computational molecular dynamics simulations for transport mechanism elucidation

These approaches can overcome traditional limitations in membrane protein research by providing dynamic insights into structure-function relationships that complement static biochemical assays.

How can researchers integrate multi-omics approaches to understand PotC in broader cellular contexts?

A comprehensive understanding of PotC function requires integration across multiple levels of biological organization:

  • Genomics: Comparative analysis of potC gene conservation and variation across bacterial species

  • Transcriptomics: Examination of expression patterns under different growth conditions

  • Proteomics: Identification of interaction partners and post-translational modifications

  • Metabolomics: Measurement of polyamine pools and flux in response to PotC manipulation

  • Systems biology: Development of mathematical models that predict transport dynamics

This integrated approach can reveal how PotC function contributes to bacterial physiology and pathogenesis beyond its immediate role in polyamine transport. When designing such multi-faceted studies, researchers must carefully control for confounding factors and ensure that experimental manipulations specifically target PotC without introducing unintended effects on other cellular processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.