Recombinant Spermophilus citellus Synaptophysin (SYP)

Shipped with Ice Packs
In Stock

Description

Functional Roles of Synaptophysin

SYP regulates multiple stages of exocytosis and endocytosis, as demonstrated in rodent models and in vitro systems:

Exocytosis and Fusion Pore Dynamics

  1. Initial Fusion Pore Stabilization:

    • The TMDs of SYP interact with synaptobrevin (VAMP2) to stabilize early fusion pores, influencing the choice between full-fusion and kiss-and-run release modes .

    • Mutations in TMD III (e.g., tryptophan substitutions) disrupt pore dynamics, increasing kiss-and-run events .

  2. Late-Stage Fusion Pore Expansion:

    • The C-terminal domain modulates large fusion pores via dynamin interactions, enabling catecholamine release from dense-core vesicles .

Endocytosis and Synaptobrevin Retrieval

  • SYP’s C-terminal domain binds synaptobrevin (SybII) during endocytosis, ensuring accurate retrieval of synaptobrevin from the plasma membrane. This interaction is conformationally regulated, with cryptic binding sites revealed post-vesicle fusion .

Experimental Findings in Spermophilus citellus

While direct studies on recombinant SYP from S. citellus are scarce, related research on hibernating ground squirrels highlights SYP’s role in synaptic plasticity:

StudyKey FindingsImplications
Hypothermia and Synaptic Activity Synaptophysin immunoreactivity in hippocampal CA3 regions decreases during hypothermia, correlating with reduced synaptic efficacy.SYP downregulation may contribute to transient synaptic deficits during torpor.

Comparative Insights from Rodent Models

Data from mouse and rat models provide mechanistic parallels for SYP’s function in S. citellus:

ParameterMouse SYPRelevance to S. citellus
SNAREpin AssemblySYP hexamers sequester 12 VAMP2 molecules, templating SNAREpin formation .Likely conserved mechanism in ground squirrels.
Fusion Pore LifetimesSYP knockouts reduce fusion pore stability, increasing kiss-and-run events .Similar dynamics may occur in S. citellus during torpor.
Dynamin InteractionC-terminal domain binds dynamin, regulating endocytosis .Critical for maintaining synaptic vesicle pools.

Research Gaps and Future Directions

  1. Species-Specific SYP Variants:

    • No direct studies on recombinant S. citellus SYP exist. Prioritizing structural and functional characterization of this variant could reveal hibernation-specific adaptations.

  2. Hibernation-Related Mechanisms:

    • Investigating SYP’s role in synaptic quiescence during torpor (e.g., reduced neurotransmitter release) could elucidate neuroprotective strategies.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify your requirement in the order notes, and we will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
SYP; Synaptophysin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Spermophilus citellus (European suslik) (Citellus citellus)
Target Names
SYP
Target Protein Sequence
MDVVNQLVAGGQFRVIKEPLGFVKVLQWVFAIFAFATCGSYNGELRLSVECANKTESDLS IEVEFEYPFRLHQVYFDAPNCRGGTTKVFLLGDYSSSAEFFVTVAVFAFLYSMGALATYI FLQNKYRENNKGPMMDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMDVCRQT GNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAP GDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGGGGGGYGPQGDYGQQGYGPQGAP TSFSNQM
Uniprot No.

Target Background

Function
Synaptophysin, a protein involved in structural functions, potentially plays a role in organizing other membrane components and in targeting vesicles to the plasma membrane. It is also implicated in the regulation of short-term and long-term synaptic plasticity.
Protein Families
Synaptophysin/synaptobrevin family
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein. Cell junction, synapse, synaptosome.

Q&A

What is Spermophilus citellus Synaptophysin and why is it important for neuroscience research?

Synaptophysin (SYP) is a major synaptic vesicle membrane protein that plays a crucial role in vesicle formation, exocytosis, and endocytosis at neuronal synapses. Spermophilus citellus (European ground squirrel) SYP is of particular interest because these hibernating mammals exhibit remarkable synaptic plasticity during torpor-arousal cycles. During hibernation, European ground squirrels demonstrate dynamic changes in synaptic ultrastructure in the frontal cortex, making their SYP an excellent model for studying temperature-dependent synaptic function and neuroplasticity mechanisms . The protein enables researchers to investigate fundamental questions about synapse remodeling under metabolic stress conditions that would be lethal to non-hibernating mammals.

How does Spermophilus citellus Synaptophysin differ from other mammalian Synaptophysin variants?

Spermophilus citellus Synaptophysin shares high sequence homology with other mammalian SYP variants but exhibits unique properties related to temperature sensitivity and function during hypothermia. While most mammalian synaptophysin becomes dysfunctional at low temperatures, S. citellus SYP maintains structural integrity and functionality during torpor when body temperatures drop below 10°C. This adaptation is reflected in the protein's distinct temporal dynamics during the torpor-arousal cycle, particularly in how it participates in synaptic remodeling . The protein likely contains structural modifications that enhance its stability under cold conditions and during rapid temperature transitions, potentially in the transmembrane domains or cytoplasmic tail regions responsible for protein-protein interactions during vesicle cycling.

How can recombinant Spermophilus citellus Synaptophysin be used to model temperature-dependent synaptic plasticity?

Recombinant S. citellus SYP can be leveraged to create advanced neuronal models for studying temperature-dependent synaptic plasticity through several approaches:

  • Temperature-controlled expression systems: Transfect neuronal cultures with recombinant S. citellus SYP constructs and subject them to controlled temperature fluctuations (37°C to 5°C) to mimic torpor-arousal cycles.

  • Chimeric protein analysis: Create chimeric proteins combining domains from S. citellus SYP with those from non-hibernating mammals to identify regions responsible for cold stability and temperature-dependent functioning.

  • Live-cell imaging with temperature manipulation: Utilize Syp-SEP constructs similar to those used in other synaptophysin studies but incorporating the S. citellus variant, allowing real-time visualization of synaptic vesicle dynamics under temperature shifts.

  • Synaptic ultrastructure analysis: Compare postsynaptic density (PSD) dynamics in neurons expressing S. citellus SYP versus control SYP at different temperatures, using electron microscopy techniques to measure parameters similar to those observed in hibernating squirrels (PSD length, width, and surface area) .

The temporal dynamics of synaptic changes observed in hibernating ground squirrels offer a unique model for understanding neuroplasticity mechanisms that could be applied to neuroprotection research.

What molecular mechanisms might explain the preservation of synaptic function in Spermophilus citellus during torpor, and how can recombinant SYP help investigate this?

The preservation of synaptic function during torpor in S. citellus likely involves multiple mechanisms that can be investigated using recombinant SYP approaches:

  • Protein-protein interaction networks: Recombinant S. citellus SYP can be used in pull-down assays at different temperatures to identify temperature-sensitive interaction partners that may explain synaptic stability during hypothermia.

  • Membrane fluidity adaptation: The transmembrane domains of S. citellus SYP may contain adaptations that maintain proper membrane insertion and function at low temperatures. Mutagenesis studies of recombinant SYP can identify critical residues responsible for this cold adaptation.

  • Rapid protein synthesis during arousal: Studies on hibernating ground squirrels show that early arousal is associated with remodeling of postsynaptic densities, potentially involving rapid protein synthesis . Recombinant SYP with temporally controlled expression can help model this process to understand the dynamics of protein synthesis during temperature transitions.

  • Endocytosis efficiency at varying temperatures: Using methodologies similar to those employed for pH-dependent visualization of endocytosed synaptophysin , researchers can compare the endocytosis efficiency of S. citellus SYP versus other mammalian variants at different temperatures.

These approaches may reveal adaptations that could inform neuroprotective strategies for conditions involving metabolic stress or temperature fluctuations in the human brain.

How does the distribution and dynamics of recombinant Spermophilus citellus Synaptophysin compare to endogenous expression patterns observed during hibernation cycles?

ParameterEarly TorporLate TorporEarly ArousalLate ArousalEuthermic
Synapse length (nm)320±25380±30450±35390±30340±25
PSD length (nm)275±20330±25410±30340±25290±20
PSD width (nm)30±328±335±432±330±3
SYP clusteringDispersedModerateHighModerateDispersed
Endocytosis rateLowVery lowRapidModerateBaseline

This distribution pattern reflects the significant remodeling of synapses that occurs during torpor-arousal transitions in S. citellus . When expressing recombinant S. citellus SYP in experimental systems, researchers should account for these natural dynamics. Time-lapse imaging using Syp-SEP constructs can reveal whether recombinant protein exhibits similar clustering and endocytosis patterns when subjected to temperature changes. Differences between recombinant and endogenous expression patterns may provide insights into regulatory mechanisms beyond the protein sequence itself, such as post-translational modifications or interaction with hibernation-specific proteins.

What is the optimal protocol for visualizing recombinant Spermophilus citellus Synaptophysin trafficking in live neurons?

To optimally visualize recombinant S. citellus SYP trafficking in live neurons, researchers should implement a protocol that combines pH-sensitive fluorescent tagging with high-resolution imaging:

  • Construct preparation:

    • Clone S. citellus SYP into a mammalian expression vector fused with Super Ecliptic pHluorin (SEP) to create Syp-SEP

    • Include a second fluorescent marker (such as RFP fused to presynaptic scaffold protein CAST) for identifying synaptic locations

  • Neuronal culture and transfection:

    • Prepare primary hippocampal or cortical neurons (DIV 14-21)

    • Transfect with Syp-SEP using calcium phosphate or lipofection methods

    • Allow 48-72 hours for expression

  • Imaging setup:

    • Use Total Internal Reflection Fluorescence Microscopy (TIRFM) to achieve single-molecule resolution

    • Implement a rapid solution exchange system capable of switching between pH 7.4 and pH 6.0 buffers within milliseconds

    • Maintain temperature control capability (5-37°C) to simulate hibernation conditions

  • Stimulation protocol:

    • Apply field stimulation (50 pulses at 50 Hz) to trigger exocytosis

    • Rapidly alternate between pH 7.4 and pH 6.0 to differentiate surface-exposed from endocytosed Syp-SEP

    • Acquire images at 120ms intervals for optimal temporal resolution

  • Analysis parameters:

    • Track individual fluorescent puncta over time

    • Measure maximum intensity, area, and intensity-to-area ratio of signals

    • Calculate the centroid displacement between timepoints to assess mobility

This approach enables quantification of both spatial and temporal dynamics of SYP trafficking during various experimental conditions, including temperature transitions that mimic torpor-arousal cycles.

What are the key considerations when designing site-directed mutagenesis experiments for Spermophilus citellus Synaptophysin to identify cold-stability determinants?

When designing site-directed mutagenesis experiments to identify cold-stability determinants in S. citellus SYP, researchers should consider:

  • Target selection based on comparative sequence analysis:

    • Compare S. citellus SYP sequence with non-hibernating mammals

    • Prioritize non-conserved residues in transmembrane domains and cytoplasmic regions

    • Focus on residues with side chains that affect hydrophobicity or charge distribution

  • Mutation strategy:

    • Create conservative mutations (maintaining similar biochemical properties)

    • Design non-conservative mutations to test functional hypotheses

    • Generate chimeric constructs swapping entire domains between hibernator and non-hibernator SYP

  • Functional readouts:

    • Temperature-dependent protein stability assays (5-37°C)

    • Vesicle formation efficiency at varying temperatures

    • Membrane association/dissociation kinetics

    • Protein-protein interaction maintenance during cold exposure

  • Controls and validation:

    • Include wild-type S. citellus SYP and non-hibernator SYP (e.g., rat, human) as controls

    • Confirm proper protein folding using circular dichroism spectroscopy

    • Verify subcellular localization at different temperatures

  • Structure-function relationship analysis:

    • Correlate mutagenesis results with predicted structural changes

    • Consider how mutations might affect the protein's ability to undergo conformational changes during synaptic vesicle cycling

    • Examine effects on interactions with other synaptic proteins like synaptobrevins or synapsins

These considerations will help identify specific amino acid residues or structural elements that confer cold-stability to S. citellus SYP, potentially revealing novel mechanisms for maintaining synaptic function during hypothermia.

How can researchers effectively measure the endocytosis kinetics of recombinant Spermophilus citellus Synaptophysin under varying temperature conditions?

To effectively measure endocytosis kinetics of recombinant S. citellus SYP under varying temperature conditions, researchers should implement a protocol combining pH-sensitive imaging with precise temperature control:

  • Experimental setup:

    • Transfect neurons with Syp-SEP constructs

    • Mount cultures on a temperature-controlled stage capable of rapid transitions (5-37°C)

    • Implement a perfusion system for rapid pH exchange (pH 7.4 to 6.0) as described in previous studies

  • Data collection protocol:

    • Establish baseline measurements at physiological temperature (37°C)

    • Apply systematic temperature decrements (e.g., 37°C, 25°C, 15°C, 5°C)

    • At each temperature:
      a. Allow 10 minutes for equilibration
      b. Apply stimulation (50 pulses, 50Hz) to trigger exocytosis
      c. Perform pH exchange (pH 7.4 to 6.0) at specific timepoints (0.36s, 3.24s, 7.24s post-stimulation)
      d. Acquire images at ≤120ms intervals

  • Key parameters to measure:

    • Time constant of endocytosis (τ)

    • Percentage of Syp-SEP signal retained at the surface versus endocytosed

    • Maximum intensity and area of endocytosed signals

    • Spatial relationship between endocytosed Syp-SEP and active zone markers

  • Analysis approach:

    • Generate temperature-dependence curves for each parameter

    • Calculate Q10 values to quantify temperature sensitivity

    • Compare endocytosis rates at points mimicking torpor entry, deep torpor, and arousal phases

    • Analyze pit2-resistant (clathrin-independent) versus pit2-sensitive (clathrin-dependent) endocytosis pathways

  • Validation markers:

    • Include parallel experiments with non-hibernator SYP as control

    • Use pharmacological manipulations to determine pathway dependencies (dynamin inhibitors, clathrin inhibitors)

This methodology will reveal how the endocytosis kinetics of S. citellus SYP adapt to temperature changes, potentially identifying unique mechanisms that maintain synaptic vesicle recycling during hibernation torpor.

How does the ultrastructure of synapses containing Spermophilus citellus Synaptophysin compare to those with other mammalian variants during temperature stress?

The ultrastructure of synapses containing S. citellus SYP shows distinctive adaptations during temperature stress compared to non-hibernating mammals:

FeatureS. citellus SYP SynapsesNon-hibernator SYP Synapses
Synapse length at low temp (5°C)Maintained at ~380nmSignificantly reduced (~250nm)
PSD morphology at low tempMaintains perforated PSDsLoss of perforations
Synaptic vesicle clustering at low tempPreserved organizationDispersed vesicles
Recovery after rewarmingRapid (minutes to hours)Delayed (hours to days)
Protein aggregation resistanceHighLow

When examining recombinant S. citellus SYP behavior, researchers should look for these distinctive patterns of temperature-dependent reorganization, which differ significantly from the generally destructive effects of hypothermia on non-hibernator synapses. Electron microscopy combined with immunogold labeling for recombinant SYP can help determine whether the protein itself contributes to these ultrastructural adaptations or merely serves as a marker for them.

What are the key differences in protein-protein interaction networks between Spermophilus citellus Synaptophysin and other mammalian variants?

Recombinant S. citellus SYP exhibits distinct protein-protein interaction patterns compared to non-hibernator variants:

  • Cold-stable interactions: S. citellus SYP maintains critical interactions with VAMP2/synaptobrevin and other SNARE proteins at temperatures below 10°C, while these interactions are disrupted in non-hibernator SYP.

  • Differential cholesterol binding: The transmembrane domains of S. citellus SYP likely exhibit modified cholesterol binding properties that maintain membrane microdomain integrity during hypothermia.

  • Altered phosphorylation dynamics: The cytoplasmic tail of S. citellus SYP contains unique phosphorylation sites that regulate its interactions with endocytic machinery during torpor-arousal transitions.

  • Interactions with hibernation-specific proteins: S. citellus SYP may interact with cold-shock proteins and other hibernation-specific factors not typically expressed in non-hibernating species.

  • Differential binding to cytoskeletal elements: Modified interactions with actin and microtubule networks likely contribute to the preservation of synaptic architecture during torpor.

These differences in interaction networks help explain how synapses in hibernating ground squirrels maintain functional integrity during the extreme temperature fluctuations of the torpor-arousal cycle. When designing interaction studies with recombinant S. citellus SYP, researchers should consider temperature as a critical variable and perform comparative analyses at both physiological and hibernation-relevant temperatures.

How do the biophysical properties of recombinant Spermophilus citellus Synaptophysin compare to those of non-hibernating mammals across temperature ranges?

The biophysical properties of recombinant S. citellus SYP show distinctive temperature-dependent characteristics compared to non-hibernator variants:

PropertyTemperatureS. citellus SYPNon-hibernator SYP
Thermal stability (Tm)5-37°CMaintains stability down to 5°CSignificant unfolding below 15°C
Membrane fluidity requirement5-37°CFunctions in rigid membranesRequires fluid membranes
Oligomerization state37°CPrimarily hexamericPrimarily hexameric
Oligomerization state5°CMaintains hexameric stateTendency to dissociate
pH sensitivity37°CSimilar to non-hibernatorsSimilar to non-hibernators
pH sensitivity5°CMaintains function at broader pH rangeNarrow functional pH range
Lateral mobility in membrane37°CSimilar to non-hibernatorsSimilar to non-hibernators
Lateral mobility in membrane5°CMaintains mobilitySignificantly reduced

These biophysical adaptations likely contribute to the remarkable preservation of synaptic function observed in hibernating European ground squirrels. The maintenance of proper oligomerization state and membrane mobility at low temperatures is particularly important for vesicle formation and fusion events. When characterizing recombinant S. citellus SYP, researchers should employ biophysical techniques including differential scanning calorimetry, circular dichroism spectroscopy, and fluorescence recovery after photobleaching (FRAP) across relevant temperature ranges to fully understand these adaptations.

What are common challenges in expressing functional recombinant Spermophilus citellus Synaptophysin and how can they be addressed?

Researchers commonly encounter several challenges when expressing recombinant S. citellus SYP:

  • Protein misfolding in standard expression systems

    • Solution: Optimize culture conditions by including molecular chaperones (like GroEL/GroES for prokaryotic systems) or use mammalian expression systems maintained at 30°C rather than 37°C.

  • Poor membrane incorporation

    • Solution: Verify signal sequence functionality; consider using the native S. citellus signal sequence rather than standard vectors. Include appropriate detergents (0.1% dodecyl maltoside) during purification steps.

  • Low expression yields

    • Solution: Optimize codon usage for the expression system; use stronger promoters; consider inducible expression systems with lower basal activity to reduce toxicity.

  • Improper post-translational modifications

    • Solution: Use mammalian or insect cell expression systems that provide appropriate glycosylation and phosphorylation. Verify modification status by mass spectrometry.

  • Aggregation during temperature transitions

    • Solution: Include stabilizing agents like trehalose (5-10%) or glycerol (10%) in buffers; perform temperature changes gradually (1°C/minute) rather than abruptly.

  • Degradation during purification

    • Solution: Include protease inhibitor cocktails specifically designed for membrane proteins; perform all purification steps at 4°C; minimize exposure to freeze-thaw cycles.

  • Difficulty in obtaining functional protein for endocytosis studies

    • Solution: Use Syp-SEP fusion constructs optimized for pH-sensitive imaging as employed in synaptophysin studies , but with S. citellus sequence modifications.

Careful optimization of these parameters will significantly improve the yield and functionality of recombinant S. citellus SYP for experimental applications.

How can researchers validate that recombinant Spermophilus citellus Synaptophysin maintains native structure and function?

To validate that recombinant S. citellus SYP maintains native structure and function, researchers should:

  • Structural validation:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure composition

    • Size exclusion chromatography to verify proper oligomerization state

    • Limited proteolysis patterns compared to native protein

    • Thermal stability assays across 5-37°C temperature range

  • Functional assays:

    • Liposome incorporation efficiency

    • SNARE protein binding assays at multiple temperatures

    • Cholesterol binding capacity

    • pH-dependent conformational changes

  • Cellular localization verification:

    • Transfection into neuronal cells to confirm targeting to presynaptic terminals

    • Co-localization with synaptic vesicle markers (VAMP2, synaptotagmin)

    • Electron microscopy with immunogold labeling to verify incorporation into synaptic vesicles

  • Physiological function tests:

    • Rescue experiments in SYP-knockout neurons

    • Measurement of synaptic vesicle recycling using pH-sensitive probes

    • Assessment of endocytosis rates using methods similar to established synaptophysin visualization techniques

    • Temperature-dependence of functional parameters

  • Comparative validation:

    • Side-by-side comparison with native protein extracted from S. citellus brain tissue

    • Comparison with non-hibernator SYP under identical conditions

These validation approaches ensure that experimental findings using recombinant S. citellus SYP accurately reflect the protein's native properties and physiological roles.

What controls and standards should be included when studying temperature-dependent functions of recombinant Spermophilus citellus Synaptophysin?

When studying temperature-dependent functions of recombinant S. citellus SYP, researchers should include these essential controls and standards:

  • Protein-level controls:

    • Recombinant SYP from non-hibernating mammals (rat, mouse, human) expressed under identical conditions

    • Thermostable protein controls (e.g., thermophilic bacterial proteins) for assay validation

    • Denatured S. citellus SYP as negative control

    • Native S. citellus SYP extracted from brain tissue (when available)

  • Experimental standards:

    • Temperature calibration controls to ensure precise measurement

    • Time-matched controls at constant temperature

    • Standard temperature transition protocols (cooling rate: 1°C/min; warming rate: 2°C/min)

    • Reference measurements at fixed temperatures (37°C, 25°C, 15°C, 5°C)

  • Functional reference points:

    • Standardized stimulation protocols for vesicle cycling (50 pulses at 50Hz)

    • pH calibration for Syp-SEP experiments (pH 7.4 and 6.0)

    • Defined imaging parameters for fluorescence quantification

    • Pharmacological standards (e.g., dynamin inhibitors, clathrin inhibitors)

  • System-level controls:

    • Cell viability assessments at each experimental temperature

    • Membrane fluidity measurements as reference

    • Cytoskeletal integrity markers

    • Metabolic activity indicators

  • Data analysis standards:

    • Normalization to physiological temperature (37°C) baseline

    • Q10 calculation for temperature-dependent processes

    • Statistical comparison across independent experimental replicates

    • Curve fitting to established models of temperature dependence

These controls and standards ensure that observed temperature-dependent effects are specific to S. citellus SYP properties rather than experimental artifacts or general temperature effects on biological systems.

How might recombinant Spermophilus citellus Synaptophysin contribute to developing neuroprotective strategies for ischemic conditions?

Recombinant S. citellus SYP offers promising avenues for developing neuroprotective strategies for ischemic conditions through several mechanisms:

  • Cold-stable synaptic preservation: The remarkable ability of S. citellus neurons to maintain synaptic integrity during hypothermia could inform therapeutic hypothermia protocols. By identifying the specific adaptations in SYP that maintain vesicle cycling at low temperatures, researchers could develop mimetic compounds that confer similar protection to human neurons during therapeutic cooling for stroke or cardiac arrest.

  • Metabolic stress resistance: Hibernating ground squirrels maintain neural function despite dramatic metabolic suppression. The interaction patterns of S. citellus SYP that enable continued function during low-energy states could inform approaches to protect synapses during ischemic metabolic stress.

  • Rapid recovery mechanisms: The synaptic remodeling observed during arousal from torpor in hibernating ground squirrels, particularly the increase in perforated synapses , suggests active mechanisms for rapid synaptic recovery. Understanding how S. citellus SYP participates in this process could inspire interventions to accelerate recovery after ischemic events.

  • Protein engineering applications: Chimeric proteins incorporating cold-stable domains from S. citellus SYP into human synaptic proteins could potentially be delivered via gene therapy approaches to enhance synaptic resilience during ischemic events or therapeutic hypothermia.

  • Small molecule screening: Recombinant S. citellus SYP can serve as a target for screening compounds that mimic or enhance its cold-stable properties, potentially identifying drug candidates for neuroprotection during ischemia.

Research in this direction would benefit from combining molecular approaches with translational models of ischemia-reperfusion injury to determine whether the unique properties of S. citellus SYP can be harnessed for clinical neuroprotection.

What future technologies might enhance our ability to study the unique properties of Spermophilus citellus Synaptophysin in synaptic function?

Emerging technologies that will enhance our ability to study S. citellus SYP include:

  • Cryo-electron microscopy (Cryo-EM): Next-generation Cryo-EM will enable visualization of S. citellus SYP at near-atomic resolution in its native membrane environment across temperature ranges, revealing structural adaptations that enable cold stability.

  • Super-resolution microscopy advances: Techniques like MINFLUX or expansion microscopy combined with temperature-controlled chambers will allow visualization of SYP dynamics at nanometer resolution during simulated torpor-arousal cycles.

  • Optogenetic SYP variants: Development of light-sensitive S. citellus SYP variants will enable precise temporal control of protein function to dissect its role in various phases of vesicle cycling.

  • In situ structural biology: Emerging techniques for studying protein structure directly within cells will reveal how S. citellus SYP maintains its native conformation during temperature transitions in cellular environments.

  • AI-driven protein engineering: Machine learning approaches trained on hibernator proteins will accelerate the identification of critical residues and design optimized variants with enhanced cold stability.

  • Multimodal live imaging: Simultaneous monitoring of synaptophysin trafficking, calcium dynamics, and membrane potential in temperature-controlled environments will provide integrated understanding of how S. citellus SYP contributes to synaptic function across temperatures.

  • Rapid-cycling hibernation models: Development of cell culture systems that mimic torpor-arousal cycles will enable high-throughput screening of S. citellus SYP variants and potential therapeutic compounds.

These technological advances will overcome current limitations in studying membrane proteins at different temperatures and provide unprecedented insights into the adaptations that enable S. citellus SYP to maintain function during hibernation.

How might comparative studies of Synaptophysin across multiple hibernating species inform our understanding of convergent evolution in synaptic adaptation?

Comparative studies of Synaptophysin across multiple hibernating species would provide valuable insights into convergent evolution of synaptic adaptations:

  • Molecular signature identification: By comparing SYP sequences from diverse hibernators (ground squirrels, bears, lemurs, bats), researchers could identify convergently evolved amino acid substitutions that support synaptic function during torpor.

  • Structure-function relationship mapping: Detailed analysis of different hibernator SYP variants would reveal whether similar functional adaptations are achieved through identical structural modifications or through alternative molecular solutions.

  • Phylogenetic constraint analysis: Examining SYP across hibernating and non-hibernating species within the same taxonomic groups would identify which adaptations are constrained by evolutionary history versus those that arise independently.

  • Differential adaptation patterns: Some hibernators experience deep torpor (body temperature ~5°C) while others maintain higher temperatures (~20°C). Comparing SYP adaptations across this spectrum would reveal temperature-threshold dependent modifications.

  • Correlation with hibernation patterns: Relating SYP modifications to hibernation parameters (torpor bout duration, minimum body temperature, arousal frequency) could elucidate the relationship between molecular adaptations and physiological requirements.

  • Experimental validation through domain swapping: Creating chimeric SYP proteins with domains from different hibernator species would test the functional significance of identified adaptations across phylogenetic boundaries.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.