Recombinant Sphingomonas wittichii ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Sphingomonas wittichii ATP Synthase Subunit b (atpF)

Sphingomonas wittichii is a bacterium known for its ability to degrade aromatic compounds, including pollutants like dibenzofuran and dibenzodioxin . ATP synthase is a vital enzyme complex that produces adenosine triphosphate (ATP), the primary energy currency of cells . In bacteria, ATP synthase is crucial for energy production through oxidative phosphorylation. The ATP synthase complex consists of two main parts: the F0 sector, embedded in the membrane, and the F1 sector, which protrudes into the cytoplasm. Subunit b (atpF) is a component of the F0 sector, essential for proton translocation and ATP synthesis .

Recombinant Sphingomonas wittichii ATP synthase subunit b (atpF) refers to the protein produced using recombinant DNA technology. This involves isolating the gene encoding the atpF subunit from Sphingomonas wittichii, cloning it into an expression vector, and expressing it in a host organism, such as E. coli . The recombinant protein can then be purified and used for various research purposes, including studying its structure, function, and interactions with other proteins .

Significance of ATP Synthase Subunit b (atpF)

  1. Energy Production: ATP synthase is central to energy production in bacteria. Subunit b is vital for the structural integrity and function of the F0 sector, which is responsible for proton translocation across the membrane .

  2. Pollutant Degradation: Sphingomonas wittichii's ability to degrade pollutants is energy-intensive. Functional ATP synthase is necessary to support these processes .

  3. Drug Target: ATP synthase has been identified as a potential target for antimicrobial drugs. Inhibiting ATP synthase can disrupt cellular energy production, leading to cell death. Certain dietary phytochemicals can inhibit ATP synthase, offering a therapeutic connection to combat antibiotic-resistant microbial infections .

  4. Industrial Applications: Recombinant atpF can be used to develop more efficient bioremediation strategies by understanding and optimizing the energy production pathways in Sphingomonas wittichii .

Methodology for Producing Recombinant atpF

  1. Gene Isolation: The atpF gene is isolated from the Sphingomonas wittichii genome using PCR (Polymerase Chain Reaction) with specific primers designed from the known atpF sequence .

  2. Cloning: The amplified atpF gene is inserted into a plasmid vector. The vector is chosen based on the desired expression system (e.g., E. coli) .

  3. Expression: The recombinant plasmid is transformed into a host organism (E. coli). The host cells are cultured under conditions that induce atpF gene expression .

  4. Purification: The recombinant atpF protein is purified from the host cell lysate using affinity chromatography, such as a His-tag . The purity of the protein is assessed using SDS-PAGE gel electrophoresis .

Research Findings and Applications

  1. Structural Studies: Recombinant atpF allows researchers to determine the protein's three-dimensional structure using X-ray crystallography or cryo-electron microscopy. Understanding the structure is crucial for elucidating its function and interactions .

  2. Functional Analysis: Purified atpF can be used in in vitro assays to study its role in proton translocation and ATP synthesis. These studies can involve measuring ATP production rates under different conditions .

  3. Interaction Studies: Recombinant atpF can be used to identify and study its interactions with other subunits of the ATP synthase complex. Techniques such as co-immunoprecipitation and cross-linking can be employed .

  4. Inhibition Studies: Researchers can use recombinant atpF to screen for and characterize inhibitors of ATP synthase. This is relevant for developing new antimicrobial agents .

  5. Environmental Studies: Understanding the role of atpF in Sphingomonas wittichii's metabolism can aid in optimizing bioremediation strategies for aromatic pollutants .

Data Table: Differentially Expressed Genes in Sphingomonas wittichii RW1

The following table shows differentially expressed genes of S. wittichii RW1 in short contact sand experiments :

GeneAnnotationFold change in comparison
SAL-NOTHb vs ctrl SAL
Swit_0061Ribosomal large subunit pseudouridine synthase D-5.3
Swit_0266UspA domain-containing protein-4.7
Swit_0540TonB-dependent receptor-2.6
Swit_0652Methylmalonate-semialdehyde dehydrogenase4.2
Swit_0975Muconate cycloisomerase-21.7
Swit_0976Muconolactone Delta-isomerase-12.9
Swit_0977Catechol 1,2-dioxygenase-11.4
Swit_1124Glutaredoxin3.7
Swit_1200Globin-21.8
Swit_132730S ribosomal protein S11-2.3
Swit_132830S ribosomal protein S13-2.1
Swit_133630S ribosomal protein S5-6.3
Swit_134650S ribosomal protein L16-5.6
Swit_1799Cbb3-type cytochrome oxidase component-4.4
Swit_1800Cytochrome c oxidase, cbb3-type, subunit II-3.3
Swit_24015,10-Methylenetetrahydrofolate reductase-14.3
Swit_2914FeS assembly SUF system protein-6.2
Swit_3044TonB-dependent receptor-3.1
Swit_3144TonB-dependent receptor-3.1
Swit_3256TonB-dependent receptor-2.5
Swit_3587Alkyl hydroperoxide reductase2.5
Swit_3729Hypothetical protein Swit_3729-3
Swit_3904Hypothetical protein Swit_390411.7
Swit_3960Hypothetical protein Swit_39602.5
Swit_4364Methylamine dehydrogenase accessory protein MauD9
Swit_4662BLUF domain-containing protein-2.8
Swit_5202Hypothetical protein Swit_5202-8.7

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
atpF; Swit_4486; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)
Target Names
atpF
Target Protein Sequence
MSVNASTLVADNLADAASLEGLPENVSAGHAAAGTEEHHVDPTALGMTATAWVSLAMVIV ILLLLWKKVPSVIGASLDKKIASIRANLDEAAALRADAEKLKAEYEAKAKAAAKEAEEML AHARSEAEAIVSQARVDATALIERRGKMAEDKIAAAERGAVAEVRAKAASAAAAAAGALI AERNNAKADKALIDGAIDALGNARF
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core, and the F0 domain, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel, forming part of the peripheral stalk that connects F1 and F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the structure and function of ATP synthase subunit b (atpF) in Sphingomonas wittichii?

ATP synthase subunit b (atpF) is a component of the F₀ sector of the F-type ATP synthase complex in Sphingomonas wittichii. It forms part of the peripheral stalk that connects the F₁ and F₀ sectors, playing a crucial role in the structural stability of the complex and the energy coupling mechanism. The protein is typically expressed as a partial construct when produced recombinantly, which helps overcome challenges related to membrane integration while maintaining functional domains for research applications .

How does recombinant atpF differ from native atpF in Sphingomonas wittichii?

Recombinant atpF proteins are typically expressed as partial constructs that maintain core functional domains while potentially lacking membrane-spanning regions that would complicate expression and purification. When expressed in heterologous systems like E. coli or yeast, these proteins may contain additional tags (such as His-tags or Avi-tags) to facilitate purification and detection. The recombinant versions may also lack post-translational modifications present in the native form, depending on the expression system used . In contrast, native atpF exists as part of the intact ATP synthase complex within the bacterial membrane of S. wittichii, where it functions in the context of cellular bioenergetics.

What expression systems are available for producing recombinant S. wittichii atpF?

Recombinant S. wittichii atpF can be produced in two major expression systems:

  • E. coli-based expression: This bacterial system offers high yield and relatively straightforward protocols. The protein produced is referenced by catalog numbers CSB-EP002358SUF1 and CSB-EP002358SUF1-B (for biotinylated versions) .

  • Yeast-based expression: This eukaryotic system may provide better folding conditions for complex proteins. Yeast-expressed protein is referenced by catalog number CSB-YP002358SUF1 .

The choice between these systems depends on research requirements, particularly regarding protein folding, post-translational modifications, and downstream applications.

How does atpF contribute to the adaptive responses of S. wittichii in challenging environmental conditions?

S. wittichii strain RW1 has evolved mechanisms to survive in environments with fluctuating water availability. Transcriptome profiling has shown that when exposed to permeating solutes (sodium chloride) and non-permeating solutes (PEG8000), S. wittichii displays distinct adaptive responses .

Although the specific role of atpF in these responses was not directly detailed in the search results, ATP synthase components are typically involved in cellular energy management under stress conditions. The adaptive strategies include:

  • Increased expression of genes involved in trehalose and exopolysaccharide biosynthesis

  • Reduced expression of genes involved in flagella biosynthesis

  • Differential expression of membrane protein genes

  • Changes in membrane fatty acid composition

These adaptations likely involve bioenergetic adjustments in which ATP synthase components, including atpF, play significant roles in maintaining energy homeostasis under environmental stress.

What structural insights can be gained from studying recombinant S. wittichii atpF in comparison to ATP synthase components from other bacterial species?

Comparative structural analysis of atpF from S. wittichii with homologous proteins from other bacterial species can provide insights into the evolutionary adaptations of energy-transducing systems across different ecological niches.

While S. wittichii atpF shares the fundamental function of other bacterial ATP synthase b subunits, its specific sequence characteristics may reflect adaptations to the organism's lifestyle as an environmental pollutant degrader, particularly of dibenzo-p-dioxins and dibenzofurans . These adaptations might involve:

  • Structural modifications that enhance stability under oxidative stress conditions encountered during pollutant degradation

  • Interface adaptations for optimal interaction with other ATP synthase components

  • Regulatory features that respond to environmental signals specific to S. wittichii's ecological niche

Researchers can use recombinant atpF to investigate these structural features through crystallography, cryo-electron microscopy, or comparative biochemical analyses.

What are the optimal storage and handling conditions for recombinant S. wittichii atpF?

Based on recommended protocols for similar ATP synthase components from S. wittichii (such as subunit beta and subunit a), the following storage and handling conditions are advised:

  • Long-term storage: Store at -20°C/-80°C. For extended storage, conserve at -80°C .

  • Reconstitution: Briefly centrifuge the vial before opening to bring contents to the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Working aliquots: Add glycerol to a final concentration of 5-50% (recommended 50%) and prepare working aliquots for storage at -20°C/-80°C .

  • Working storage: Store working aliquots at 4°C for up to one week .

  • Avoid repeated freeze-thaw cycles: This significantly reduces protein activity .

These conditions help maintain protein stability and functionality for research applications.

What purification strategies are most effective for recombinant S. wittichii atpF?

While specific purification protocols for atpF were not detailed in the search results, effective strategies can be inferred from standard practices for similar recombinant proteins:

For His-tagged versions:

  • Immobilized Metal Affinity Chromatography (IMAC): Using Ni-NTA or Co2+ resins as the primary purification step

  • Size Exclusion Chromatography (SEC): As a polishing step to remove aggregates and achieve >90% purity

For Avi-tag Biotinylated versions (CSB-EP002358SUF1-B):

  • Streptavidin affinity chromatography: Utilizing the highly specific interaction between biotin and streptavidin

  • Ion Exchange Chromatography (IEX): As a secondary purification step based on the protein's isoelectric point

The biotinylated version offers advantages for applications requiring oriented immobilization, as the biotinylation occurs in vivo through AviTag-BirA technology, which creates a specific amide linkage between biotin and the lysine residue within the AviTag sequence .

What analytical methods are recommended for quality control of recombinant S. wittichii atpF preparations?

Based on standard practices for recombinant ATP synthase components, the following analytical methods are recommended:

  • SDS-PAGE: For purity assessment (target >85% purity) and molecular weight confirmation

  • Western blotting: For identity confirmation using antibodies against the target protein or tag

  • Mass spectrometry: For accurate molecular weight determination and sequence verification

  • Dynamic light scattering (DLS): To assess homogeneity and detect aggregation

  • Functional assays: To confirm biological activity, potentially including:

    • ATP binding assays

    • Interaction studies with other ATP synthase components

    • Structural integrity assessments via circular dichroism

For biotinylated versions, additional quality control should include:

  • Streptavidin binding assays to confirm successful biotinylation

  • Quantification of biotin:protein ratio

How should researchers design experiments to study interactions between atpF and other ATP synthase components?

When designing experiments to study interactions between atpF and other ATP synthase components, researchers should consider:

  • Co-expression strategies:

    • Design constructs for co-expression of atpF with interacting partners

    • Consider using polycistronic expression systems that mimic natural operon organization

  • Interaction analysis methods:

    • Surface Plasmon Resonance (SPR) using immobilized atpF

    • Pull-down assays using tagged versions of atpF

    • Native PAGE analysis of reconstituted subcomplexes

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

    • FRET-based approaches for real-time interaction studies

  • Structural analysis:

    • Use of cross-linking mass spectrometry (XL-MS) to capture transient interactions

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction surfaces

    • Cryo-EM of reconstituted subcomplexes containing atpF

When using biotinylated atpF (CSB-EP002358SUF1-B), researchers can leverage the highly specific and strong biotin-streptavidin interaction for oriented immobilization on streptavidin-coated surfaces, providing advantages for interaction studies with precise spatial control .

What factors should be considered when using recombinant S. wittichii atpF for structural studies?

When using recombinant S. wittichii atpF for structural studies, researchers should consider:

  • Protein stability considerations:

    • Buffer optimization through thermal shift assays

    • Addition of stabilizing agents (glycerol, specific ions, mild detergents)

    • Storage at appropriate temperature (-20°C/-80°C for long-term)

  • Sample preparation for structural techniques:

    • For crystallography: Screening of crystallization conditions with and without interacting partners

    • For cryo-EM: Optimization of grid preparation and vitrification conditions

    • For NMR: Isotopic labeling strategies if using E. coli expression systems

  • Construct design considerations:

    • The partial construct available commercially may be optimized for solubility but might lack key structural elements

    • Consider custom construct design that includes specific domains of interest

    • Tag position and linker composition can affect structural studies

  • Reconstitution with lipids or detergents:

    • For membrane-associated studies, appropriate lipid/detergent environments may be crucial

    • Consider nanodiscs or liposomes for more native-like environments

What are common challenges when working with recombinant S. wittichii atpF and how can they be addressed?

Common challenges and their solutions include:

ChallengePotential SolutionRationale
Low solubilityUse solubility-enhancing tags (MBP, SUMO)These tags can improve folding and solubility
Protein aggregationAdd stabilizing agents (5-10% glycerol)Prevents non-specific hydrophobic interactions
Low expression yieldOptimize codon usage for expression hostImproves translation efficiency
Proteolytic degradationInclude protease inhibitors during purificationPrevents degradation by endogenous proteases
Poor reconstitutionTest different buffer conditions (pH 7-8)Optimizes electrostatic interactions
Loss of activity after freeze-thawPrepare single-use aliquotsAvoids repeated freeze-thaw cycles
Non-specific binding in assaysInclude BSA or mild detergents in buffersReduces non-specific interactions

How can researchers distinguish between experimental artifacts and genuine findings when studying recombinant S. wittichii atpF?

To distinguish between artifacts and genuine findings:

  • Include appropriate controls:

    • Use tag-only proteins to identify tag-mediated effects

    • Include denatured protein controls to distinguish specific from non-specific interactions

    • Test multiple batches of protein to ensure reproducibility

  • Validate with complementary techniques:

    • Confirm interactions observed in vitro with in vivo approaches when possible

    • Use multiple biophysical methods to corroborate structural findings

    • Compare results with homologous proteins from related organisms

  • Consider native context:

    • Remember that atpF functions as part of a complex in vivo

    • Isolated protein behavior may differ from its behavior in the complete ATP synthase complex

    • When possible, compare with native ATP synthase behavior

  • Statistical validation:

    • Apply appropriate statistical tests to distinguish significant differences

    • Report effect sizes along with p-values

    • Consider biological significance beyond statistical significance

How does research on S. wittichii atpF contribute to understanding bacterial adaptation to environmental stressors?

Research on S. wittichii atpF contributes to understanding bacterial adaptation to environmental stressors in several ways:

  • Energy metabolism under stress conditions:

    • S. wittichii strain RW1 demonstrates distinct adaptive responses to different water potential stressors (solute vs. matric stress)

    • As an ATP synthase component, atpF likely plays a role in modulating energy production under stress

    • Understanding these adaptations could provide insights into bacterial survival mechanisms in fluctuating environments

  • Membrane bioenergetics in pollutant-degrading bacteria:

    • S. wittichii can oxidize persistent pollutants like dibenzo-p-dioxins and dibenzofurans

    • This metabolic capability may require specialized bioenergetic adaptations

    • ATP synthase components, including atpF, may have evolved specific features to support these specialized metabolic pathways

  • Comparative bioenergetics across bacterial species:

    • Comparing atpF structure and function across different bacteria can illuminate evolutionary adaptations

    • This could reveal how ATP synthase components adapt to different ecological niches and metabolic requirements

What implications does research on bacterial ATP synthase components have for antimicrobial development?

While not directly addressed in the search results, research on bacterial ATP synthase components, including S. wittichii atpF, has important implications for antimicrobial development:

  • ATP synthase as a drug target:

    • Bacterial ATP synthase is structurally distinct from human mitochondrial ATP synthase

    • These differences can be exploited for selective inhibition

    • Understanding the structure and function of bacterial ATP synthase components can guide rational drug design

  • Addressing antimicrobial resistance:

    • Novel targets are needed to overcome resistance to current antibiotics

    • ATP synthase represents an essential process with limited redundancy

    • Targeting different components like atpF could provide new avenues for antimicrobial development

  • Cross-species applications:

    • Insights from environmental bacteria like S. wittichii can inform approaches to pathogenic species

    • Structural and functional conservation across bacterial ATP synthases enables knowledge transfer

    • Specialized adaptations identified in environmental bacteria may inspire novel inhibition strategies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.