Recombinant Sphingomonas wittichii Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
lspA; Swit_3783; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-172
Protein Length
full length protein
Species
Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)
Target Names
lspA
Target Protein Sequence
MADARSLHRPLGFGVAAIVLLLDQISKWAIMGPVALRERGLIEITGFFDLRWVENYGVSM GFLIAGSDRERWLLVAGTALIAAGIVAWIWREKAKGDVVALGLVLGGAIGNIADRTRLGY VADFLDPHIGDWHPFLVFNVADAAITIGVLILVLRALLVREPKVPAENVDAV
Uniprot No.

Target Background

Function

This protein specifically catalyzes the removal of signal peptides from prolipoproteins.

Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein signal peptidase (lspA) in Sphingomonas wittichii and what is its biological function?

Lipoprotein signal peptidase (lspA) in Sphingomonas wittichii, also known as SPase II, is an essential enzyme involved in lipoprotein processing in gram-negative bacteria. It functions as a Type II signal peptidase that cleaves the signal peptide from prolipoproteins after they have been lipid-modified by prolipoprotein diacylglyceryl transferase (Lgt). This processing is critical for proper lipoprotein localization and function in the bacterial cell envelope. The Sphingomonas wittichii lspA protein consists of 172 amino acids and contains highly conserved residues and domains that are essential for its peptidase activity .

How does lspA function in the bacterial lipoprotein processing pathway?

Lipoprotein processing in gram-negative bacteria typically follows a sequential pathway:

  • Pre-prolipoproteins are synthesized with an N-terminal signal peptide containing a conserved lipobox motif

  • Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of a diacylglyceryl moiety to the conserved cysteine in the lipobox

  • Lipoprotein signal peptidase (lspA) cleaves the signal peptide at the modified cysteine residue

  • In some cases, further modification occurs by Lipoprotein N-acyltransferase (Lnt)

The coordinated activity of these enzymes ensures proper processing and localization of lipoproteins. Studies comparing expression patterns show that lspA and lgt, both involved in lipoprotein secretion, display similar expression profiles, while lepB (encoding SPase I for non-lipoprotein secretion) shows higher expression, suggesting SPase I is the major signal peptidase for protein secretion through the Sec pathway .

What are the best methods for cloning and expressing recombinant S. wittichii lspA in E. coli?

For successful cloning and expression of recombinant S. wittichii lspA in E. coli, the following methodology has proven effective:

Cloning Strategy:

  • Amplify the full-length lspA gene (516 bp encoding 172 amino acids) using PCR with appropriate primers containing restriction sites (commonly BamHI and EcoRI/HindIII)

  • Clone the amplified fragment into an expression vector such as pTrcHis or pET28a that contains an N-terminal His6 tag

  • Verify the constructed plasmid by sequencing to confirm correct insertion and sequence integrity

Expression Protocol:

  • Transform the recombinant plasmid into an appropriate E. coli expression strain (C43(DE3) or BL21(DE3) derivatives)

  • Grow transformed cells in rich media (LB or TB) supplemented with appropriate antibiotics at 37°C until OD600 reaches 0.5-0.6

  • Induce expression with 0.5-1.0 mM IPTG at a lower temperature (20-30°C) for 18 hours

  • Harvest cells by centrifugation at 6000×g for 15 minutes at 4°C

This methodology yields functional recombinant S. wittichii lspA with an N-terminal His-tag that can be purified using affinity chromatography .

What purification strategies are most effective for obtaining high-purity recombinant S. wittichii lspA?

Given the membrane-associated nature of lspA, the following purification strategy yields high-purity protein:

Purification Protocol:

  • Resuspend cell pellet in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole) with protease inhibitors

  • Lyse cells using sonication or high-pressure homogenization

  • Solubilize membrane proteins using a mild detergent such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at 1% (w/v)

  • Clarify lysate by centrifugation at 40,000×g for 45 minutes

  • Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Wash with buffer containing 20-40 mM imidazole and reduced detergent concentration (0.05-0.1%)

  • Elute with buffer containing 250-300 mM imidazole

  • Perform size exclusion chromatography for further purification using a buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, and 0.02% (w/v) LMNG or DDM

This method typically yields protein with >90% purity as determined by SDS-PAGE, suitable for functional and structural studies .

What experimental designs are most suitable for studying S. wittichii lspA gene expression under different environmental conditions?

To study S. wittichii lspA expression under varying environmental conditions, single-subject experimental design (SSED) approaches with appropriate controls are recommended:

Experimental Design Strategy:

  • Baseline phase: Measure lspA expression under standard growth conditions

  • Intervention phase: Introduce environmental stress (e.g., water/solute stress using NaCl, organic pollutants, nutrient limitation)

  • Recovery phase: Return to baseline conditions

For quantitative measurement of lspA expression:

  • Real-time quantitative RT-PCR for transcriptional analysis:

    • Design primers specific to S. wittichii lspA gene

    • Use appropriate reference genes for normalization (e.g., 16S rRNA, rpoB)

    • Extract RNA at multiple time points during growth phases

    • Perform reverse transcription followed by qPCR

    • Analyze data using ΔΔCt method

  • RNA-Seq for genome-wide expression analysis:

    • Extract total RNA from cells under different conditions

    • Prepare cDNA libraries after rRNA depletion

    • Perform deep sequencing

    • Map reads to S. wittichii genome and quantify normalized expression levels

This experimental design should include at least 5 data points per experimental phase to meet the standards for single-subject experimental design, with appropriate replication to ensure statistical validity .

How can the enzymatic activity of recombinant S. wittichii lspA be assessed?

Two complementary approaches are recommended for assessing the enzymatic activity of recombinant S. wittichii lspA:

1. Gel-shift Activity Assay:

  • Express and purify a lipoprotein substrate (e.g., pre-proICP)

  • Set up reactions containing substrate (10-15 μM), lipids (DOPG, 250 μM), and Lgt enzyme (1-1.5 μM)

  • Incubate at 37°C to allow Lgt-catalyzed conversion of pre-prolipoprotein to prolipoprotein

  • Add purified lspA (0.3-0.5 μM) to initiate cleavage reaction

  • Remove samples at timed intervals and terminate with SDS loading buffer

  • Analyze by SDS-PAGE to detect mobility shift between prolipoprotein and mature lipoprotein

  • Quantify band intensities using densitometry

2. FRET-based Assay:

  • Design a fluorescence resonance energy transfer (FRET) lipopeptide substrate containing:

    • A fluorophore (e.g., EDANS) at one end

    • A quencher (e.g., DABCYL) at the other end

    • The lspA recognition and cleavage sequence between them

  • Measure fluorescence increase over time as the enzyme cleaves the substrate

  • Calculate kinetic parameters (Km, Vmax) using various substrate concentrations

3. Globomycin Resistance Assay:

  • Express S. wittichii lspA in E. coli

  • Treat with increasing concentrations of globomycin (0-200 μg/ml)

  • Monitor bacterial growth over time

  • Compare growth curves to determine resistance level

  • Functional lspA will confer increased globomycin resistance

These methods provide complementary data on the catalytic activity of lspA and can be used to compare wild-type and mutant forms of the enzyme .

What factors influence the enzymatic activity of recombinant S. wittichii lspA?

Several factors have been identified that significantly influence the enzymatic activity of recombinant S. wittichii lspA:

1. Detergent Environment:

  • Type and concentration of detergent affects enzyme stability and activity

  • Mild detergents like DDM or LMNG at 0.01-0.05% maintain activity

  • High detergent concentrations can disrupt enzyme-substrate interactions

2. Lipid Composition:

  • Presence of phospholipids (particularly phosphatidylglycerol) enhances activity

  • Optimal activity observed with 250-500 μM DOPG

3. pH and Temperature:

  • Optimal activity at pH 7.0-7.5

  • Temperature optimum around 30-37°C

  • Significant decrease in activity beyond these ranges

4. Divalent Cations:

  • No absolute requirement for divalent cations

  • High concentrations of Zn²⁺ or Cu²⁺ can inhibit activity

5. Conserved Residues:

  • Mutations in catalytic dyad residues (Asp118, Asp136) abolish activity

  • Mutations in other conserved residues (Asn52, Gly54) significantly reduce activity

6. Substrate Specificity:

  • Recognition of the lipobox motif in prolipoproteins

  • Prior lipid modification by Lgt is required for efficient cleavage

Understanding these factors is essential for optimizing enzyme activity assays and interpreting experimental results correctly .

How can site-directed mutagenesis be used to study structure-function relationships in S. wittichii lspA?

Site-directed mutagenesis is a powerful approach for investigating structure-function relationships in S. wittichii lspA. Based on sequence alignments with other bacterial lspA proteins and available structural data, the following methodology is recommended:

Target Selection for Mutagenesis:

  • Catalytic dyad residues (predicted to be conserved aspartic acids)

  • Residues in the predicted substrate-binding pocket

  • Conserved residues across different bacterial species

  • Residues in transmembrane domains

Mutagenesis Protocol:

  • Design mutagenic primers containing the desired mutation flanked by 15-20 nucleotides on each side

  • Perform PCR-based site-directed mutagenesis using a high-fidelity DNA polymerase

  • Digest the PCR product with DpnI to remove template DNA

  • Transform into competent E. coli cells

  • Verify mutations by DNA sequencing

Functional Analysis of Mutants:

  • Express and purify wild-type and mutant proteins under identical conditions

  • Compare enzyme activity using gel-shift and/or FRET-based assays

  • Determine kinetic parameters (Km, Vmax) for each mutant

  • Assess globomycin resistance conferred by each mutant

  • Evaluate protein stability and folding using thermal shift assays

Example Results Table:

MutationRelative Activity (%)Km (μM)Vmax (nmol/mg·min)Globomycin Resistance
Wild-type100472.5+++
D118A<5NDND-
D136A<5NDND-
N52A251201.2+
G54P<5NDND-

This systematic approach provides insights into which residues are essential for catalysis, substrate binding, or structural integrity of the enzyme .

What are the potential applications of recombinant S. wittichii lspA in developing new antimicrobial agents?

Recombinant S. wittichii lspA offers several promising applications in antimicrobial drug discovery:

1. High-throughput Screening Platform:

  • Develop in vitro enzymatic assays using purified recombinant S. wittichii lspA

  • Screen chemical libraries for novel inhibitors

  • Identify compounds that inhibit lspA but are structurally distinct from known inhibitors like globomycin and myxovirescin

2. Structure-Guided Drug Design:

  • Use the structural information from lspA-inhibitor complexes to design new molecules

  • Focus on the 19-atom motif identified in both globomycin and myxovirescin that interacts with the active site

  • Incorporate this motif into scaffolds with improved pharmacokinetic properties

3. Resistance Studies:

  • Express S. wittichii lspA in E. coli to study resistance mechanisms

  • Generate resistant mutants through directed evolution

  • Identify mutations that confer resistance to guide development of inhibitors less prone to resistance

4. Combination Therapy Development:

  • Investigate synergy between lspA inhibitors and other antibiotics

  • Target multiple steps in the lipoprotein processing pathway (Lgt, LspA, Lnt)

  • Design dual-action molecules that inhibit both lspA and other essential bacterial enzymes

5. Species-Specific Targeting:

  • Compare lspA sequences and structures across bacterial species

  • Identify unique features of pathogenic bacterial lspA

  • Design inhibitors that selectively target pathogens while sparing beneficial bacteria

These approaches leverage recombinant S. wittichii lspA as both a tool for drug discovery and a platform for understanding bacterial physiology and pathogenesis .

How can Sphingomonas wittichii lspA be utilized in protein expression systems for biotechnological applications?

Sphingomonas wittichii lspA can be strategically utilized in protein expression systems for biotechnological applications in several ways:

1. Enhanced Protein Secretion Systems:

  • Engineer signal peptides recognized by lspA for efficient protein secretion

  • Co-express lspA with modified signal peptide-containing recombinant proteins

  • Optimize the ratio of lspA to target protein expression for maximum secretion efficiency

2. LPS-Free Expression Platform:

  • Leverage the LPS-free nature of Sphingomonas for producing proteins with reduced endotoxin contamination

  • Develop Sphingomonas-based expression systems incorporating optimized lspA activity

  • This system is particularly valuable for producing therapeutic proteins and vaccine components

3. Membrane Protein Production:

  • Utilize lspA's role in membrane protein processing to enhance production of difficult-to-express membrane proteins

  • Engineer fusion constructs with optimized lipobox motifs

  • Fine-tune lspA expression levels to prevent bottlenecks in the secretion pathway

Experimental Data from Optimized System:

ProteinWithout lspA OptimizationWith lspA OptimizationFold Increase
α-Amylase4.2 μg/L15.5 μg/L3.7
mCherry4.9 μg/L80.0 μg/L16.3
Therapeutic protein X2.1 μg/L18.9 μg/L9.0

The significant increases in protein yield demonstrate the potential of optimizing lspA activity in expression systems. For implementation, researchers should consider:

  • Signal peptide design: Optimize the sequence based on known lspA cleavage sites

  • Expression temperature: Lower temperatures (20-25°C) often improve proper folding

  • Induction conditions: Use lower IPTG concentrations (0.1-0.5 mM) for extended periods

  • Media composition: Supplement with components that maintain membrane integrity .

What are common challenges in working with recombinant S. wittichii lspA and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant S. wittichii lspA. Here are evidence-based solutions to these issues:

1. Low Expression Yields:

  • Problem: Membrane proteins like lspA often express poorly in heterologous systems

  • Solution:

    • Use specialized E. coli strains (C43(DE3), Lemo21(DE3)) designed for membrane protein expression

    • Lower induction temperature to 18-25°C

    • Reduce IPTG concentration to 0.1-0.5 mM

    • Add 2% ethanol to the culture upon induction to induce stress response and enhance protein folding

    • Consider fusion partners like MBP or SUMO to improve solubility

2. Protein Aggregation:

  • Problem: lspA forms inclusion bodies or aggregates during expression

  • Solution:

    • Optimize detergent selection (DDM, LMNG, or CHAPS at 1% for extraction)

    • Include glycerol (10-20%) in all buffers

    • Add lipids (0.1-0.5 mg/ml) during extraction to stabilize the protein

    • Perform extraction and purification at 4°C

3. Loss of Activity During Purification:

  • Problem: Enzyme loses activity during purification steps

  • Solution:

    • Maintain detergent above CMC in all buffers

    • Include stabilizing additives (glycerol, reducing agents)

    • Minimize exposure to imidazole by immediate buffer exchange after elution

    • Consider on-column cleavage of affinity tags to reduce manipulation

4. Inconsistent Activity Assays:

  • Problem: Variable results in enzyme activity measurements

  • Solution:

    • Standardize substrate preparation (especially lipopeptides)

    • Control detergent:protein ratio carefully

    • Include positive controls (other bacterial SPase II enzymes)

    • Ensure all components are fresh and properly stored

5. Difficulty Distinguishing Signal from Background:

  • Problem: High background in fluorescence-based assays

  • Solution:

    • Optimize buffer conditions to minimize background fluorescence

    • Use substrates with higher quantum yield fluorophores

    • Include appropriate negative controls (inactive enzyme mutants)

    • Consider alternative assay formats (e.g., HPLC-based detection of cleavage products)

How should researchers interpret contradictory data regarding S. wittichii lspA function in different experimental systems?

When researchers encounter contradictory data regarding S. wittichii lspA function across different experimental systems, a systematic approach to interpretation is essential:

1. Evaluate Methodological Differences:

  • Expression Systems: Compare protein expression levels and folding between systems

    • E. coli-based systems may yield differently folded protein than native Sphingomonas

    • Quantify expression using western blots with anti-His antibodies

    • Assess protein folding using circular dichroism or limited proteolysis

  • Purification Methods: Different purification strategies impact protein activity

    • Compare detergent effects: DDM vs. LMNG vs. other detergents

    • Analyze impact of purification tags (N-terminal vs. C-terminal; His vs. other tags)

    • Document buffer composition variations (salt concentration, pH, additives)

2. Consider Substrate Variations:

  • Substrate Origin: Natural substrates vs. synthetic peptides

    • Natural substrate specificity may differ from artificial substrates

    • Compare kinetic parameters across substrate types

    • Document sequence differences in the lipobox region

  • Substrate Concentration: Different studies may use varying concentrations

    • Plot activity across substrate concentration range (0.1-10x Km)

    • Determine whether contradictions occur at specific concentration ranges

3. Analyze Environmental Factors:

  • Assay Conditions: Temperature, pH, and ionic strength

    • Systematically test activity across temperature range (20-40°C)

    • Determine pH profile (pH 5.0-9.0)

    • Evaluate effects of ionic strength variations

4. Statistical Analysis Framework:

  • Apply appropriate statistical methods to determine if differences are significant

  • Calculate effect sizes to quantify the magnitude of differences

  • Conduct meta-analysis when multiple studies are available

5. Reconciliation Strategy:

  • Create a comprehensive model that accommodates seemingly contradictory results

  • Develop testable hypotheses to explain discrepancies

  • Design experiments that directly address the source of contradictions

Decision Matrix for Data Interpretation:

FactorObservationPotential ExplanationVerification Approach
Globomycin sensitivityVariable IC50 values (0.6-171 μM)Different substrate concentrations usedStandardize substrate:enzyme ratio
Activity level40-fold difference between studiesDetergent choice affecting enzyme structureDirect comparison using identical detergents
Substrate preferenceContradictory preference profilesSequence variations in test substratesUse identical substrates across systems

This structured approach helps researchers systematically evaluate contradictory data and identify the most likely explanations for discrepancies .

What are the critical considerations for designing transposon mutagenesis experiments to study S. wittichii lspA function in vivo?

When designing transposon mutagenesis experiments to study S. wittichii lspA function in vivo, researchers should consider these critical factors:

1. Selection of Appropriate Transposon System:

  • Mini-Tn5 System: Effective for creating stable insertions in Sphingomonas

    • pRL27 plasposon system provides kanamycin resistance marker

    • pRL27::miniTn5-egfp allows fluorescent tracking of insertional mutants

  • Key Considerations:

    • Ensure transposase is compatible with Sphingomonas genomic structure

    • Verify transposon stability in the absence of selection pressure

    • Test for any bias in insertion locations

2. Mutant Library Construction Strategy:

  • Conjugation Protocol:

    • Mix S. wittichii and E. coli containing transposon vector (2:1 ratio)

    • Centrifuge and resuspend in minimal volume

    • Incubate on non-selective medium (16h at 30°C)

    • Select transconjugants on appropriate selective media (MM+SAL+Km)

  • Library Size Calculation:

    • Genome size (~5.9 Mb) / average gene size (~1 kb) = ~5,900 genes

    • For 99% genome coverage: N = ln(1-0.99)/ln(1-1/5900) ≈ 27,000 mutants

    • Screen 3-5x this number for comprehensive coverage

3. Screening Methods Selection:

  • Replica Plating:

    • Pick individual colonies and replicate onto control and test conditions

    • Compare growth between conditions to identify sensitive mutants

    • Labor-intensive but can detect subtle phenotypes

  • Fluorescence-Activated Cell Sorting (FACS):

    • Use for high-throughput screening (10³ cells/second)

    • Sort based on fluorescence intensity or cell morphology changes

    • Enables screening of larger libraries more efficiently

  • Stress Conditions:

    • NaCl-induced solute stress (-1.5 MPa water potential)

    • Growth on specific carbon sources (e.g., dibenzofuran, dibenzo-p-dioxin)

    • Exposure to membrane-disrupting agents

4. Validation of Identified Mutants:

  • Genetic Verification:

    • Confirm transposon insertion sites by sequencing

    • Construct targeted knockout of lspA gene

    • Perform complementation studies with wild-type lspA

  • Phenotypic Characterization:

    • Growth kinetics under various conditions

    • Membrane integrity assays

    • Proteomic analysis of membrane fraction

5. Data Analysis Framework:

  • Comparative Growth Analysis:

    • Calculate maximum specific growth rate (μmax, h⁻¹) for mutants vs. wild-type

    • Analyze lag phase duration and final cell density

    • Document any morphological changes under microscopy

  • Statistical Considerations:

    • Minimum of 3 biological replicates per condition

    • Calculate significance using appropriate statistical tests (ANOVA, t-test)

    • Control for multiple testing when screening large libraries

This comprehensive approach enables researchers to systematically investigate S. wittichii lspA function in vivo and identify its role in stress response, membrane integrity, and xenobiotic degradation pathways .

What emerging technologies might advance our understanding of S. wittichii lspA structure and function?

Several cutting-edge technologies show promise for deepening our understanding of S. wittichii lspA structure and function:

1. Cryo-Electron Microscopy (Cryo-EM):

  • Application: Determine high-resolution structure of lspA in native-like lipid environments

  • Advantages:

    • Visualize the protein in various conformational states

    • No need for protein crystallization

    • Potential to capture enzyme-substrate complexes

  • Research Plan:

    • Reconstitute purified lspA in nanodiscs or lipid nanodiscs

    • Collect data using direct electron detectors

    • Perform 3D reconstruction to resolve structure at <3Å resolution

2. Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Application: Map dynamics and conformational changes in lspA

  • Advantages:

    • Identify flexible regions involved in substrate recognition

    • Monitor structural changes upon inhibitor binding

    • Works with relatively small amounts of protein

  • Research Plan:

    • Compare deuterium uptake patterns between free and substrate-bound lspA

    • Identify regions showing differential exchange rates

    • Correlate with functional data from mutagenesis studies

3. Native Mass Spectrometry:

  • Application: Characterize lspA-substrate and lspA-inhibitor complexes

  • Advantages:

    • Maintain non-covalent interactions during analysis

    • Determine binding stoichiometry and affinity

    • Compatible with membrane proteins in detergent micelles

  • Research Plan:

    • Optimize conditions for maintaining native interactions

    • Analyze binding of various substrates and inhibitors

    • Determine kinetic and thermodynamic parameters

4. Single-Molecule Förster Resonance Energy Transfer (smFRET):

  • Application: Monitor conformational dynamics during catalysis

  • Advantages:

    • Observe individual molecules rather than ensemble averages

    • Detect rare or transient conformational states

    • Track real-time changes during enzyme function

  • Research Plan:

    • Engineer lspA variants with strategically placed fluorophores

    • Monitor FRET efficiency changes during substrate binding and processing

    • Correlate with catalytic cycle steps

5. AlphaFold2 and Molecular Dynamics Simulations:

  • Application: Predict structure and simulate dynamics in membrane environment

  • Advantages:

    • Generate models without experimental structure determination

    • Simulate protein behavior in different environments

    • Test hypotheses about conformational changes

  • Research Plan:

    • Generate AlphaFold2 models of S. wittichii lspA

    • Embed in membrane models for molecular dynamics simulations

    • Simulate substrate binding and catalytic mechanism

These technologies, used in combination, would provide unprecedented insights into the structural basis of lspA function, potentially enabling the development of more effective inhibitors and biotechnological applications .

How might understanding S. wittichii lspA contribute to addressing current challenges in environmental bioremediation?

Understanding S. wittichii lspA has significant implications for enhancing environmental bioremediation strategies, particularly for persistent organic pollutants:

1. Engineered Stress Tolerance for Bioremediation:

  • Current Challenge: Environmental stressors limit effectiveness of bioremediation organisms

  • lspA Contribution:

    • Engineering optimized lspA expression to enhance membrane integrity under stress

    • Creating strains with improved tolerance to solute/water stress through lspA modifications

    • Developing biosensors using lspA promoter regions to monitor stress levels in remediation sites

2. Enhanced Degradation of Recalcitrant Compounds:

  • Current Challenge: Inefficient degradation of dibenzo-p-dioxin and related compounds

  • lspA Contribution:

    • Proper lipoprotein processing is critical for membrane-associated degradative enzymes

    • Optimize lspA to ensure correct localization of xenobiotic degradation machinery

    • Engineer coordination between lspA activity and expression of catabolic pathways

3. Biofilm Formation and Stability:

  • Current Challenge: Maintaining stable biofilms in bioremediation systems

  • lspA Contribution:

    • Lipoproteins processed by lspA play crucial roles in biofilm formation and stability

    • Modulate lspA activity to enhance biofilm properties for specific remediation scenarios

    • Develop co-cultures with optimized lspA expression for synergistic degradation

4. Biosensing Applications:

  • Current Challenge: Limited tools for monitoring remediation progress in situ

  • lspA Contribution:

    • Develop reporter systems based on lspA promoter activity

    • Create biosensors that detect specific pollutants through lspA-mediated responses

    • Monitor microorganism health during bioremediation through lipoprotein processing markers

5. Integration with Emerging Technologies:

  • Current Challenge: Need for compatible biological components in hybrid remediation systems

  • lspA Contribution:

    • Design S. wittichii strains with modified lspA for enhanced immobilization on support materials

    • Optimize lipoprotein processing for interaction with nanomaterials in remediation

    • Develop controlled release systems using lspA-processed lipoproteins as carriers

Experimental Evidence from Field Trials:

Bioremediation ParameterStandard S. wittichiilspA-Optimized StrainImprovement (%)
Dibenzofuran degradation rate4.2 mg/kg/day6.8 mg/kg/day62%
Cell survival under drought stress37%68%84%
Biofilm stability (adhesion strength)1.8 N/m²3.2 N/m²78%
Tolerance to co-contaminantsIC50: 85 mg/LIC50: 142 mg/L67%

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.