Recombinant Sphingomonas wittichii Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for customers.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. To request a specific tag, please indicate this in your order; we will prioritize fulfilling such requests.
Synonyms
htpX; Swit_1939; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)
Target Names
htpX
Target Protein Sequence
MNMLKTTMLLAALTALFMALGFTIGGTGGAMIALVVAAGMNLFTFWNADSIVLRMHGARE VDAQNCPEFVGLVAGLARRANLPMPRVYIIDSEHPNAFATGRNPENAAVAATTGLLAILN RDEIEGVMAHELAHVRNRDTLIMTMTATIAGAISMLANFGMFFGAGRRDGGQVLATILAV FVAPFAAMIVQMAISRAREYGADRGGAEISGKPQALASALAKLANGAARIPNPVVERNPA AAALYIVPGMKRDGDSLFATHPATENRIAHLEAIANEMGVSSPSPNFAALSERRGSVSSV PRTRRRSSALDPNGRG
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Sphingomonas wittichii Protease HtpX homolog and what is its functional role?

Sphingomonas wittichii Protease HtpX homolog is a membrane-bound zinc metalloproteinase belonging to the M48 family of proteases. Based on homology to the well-characterized Escherichia coli HtpX, this protein is likely involved in the quality control of membrane proteins, participating in the elimination of malfolded or misassembled membrane proteins that could otherwise compromise membrane integrity and function . The protein is encoded by the htpX gene (locus tag: Swit_1939) in Sphingomonas wittichii strain RW1 / DSM 6014 / JCM 10273 .

The enzyme is classified with the Enzyme Commission number EC 3.4.24.-, indicating it belongs to the metalloproteinases that cleave peptide bonds within proteins or peptides (endopeptidases) . Its role in prokaryotic membrane protein quality control makes it an important subject for research in bacterial physiology and stress response mechanisms.

How should Recombinant Sphingomonas wittichii Protease HtpX homolog be stored and handled for optimal activity?

For optimal activity and stability of Recombinant Sphingomonas wittichii Protease HtpX homolog, the following storage and handling protocols are recommended:

  • Storage conditions: Store at -20°C for regular use. For extended storage periods, conserve at either -20°C or -80°C .

  • Buffer composition: The protein is provided in a Tris-based buffer containing 50% glycerol, specifically optimized for this protein's stability .

  • Working aliquots: It is advisable to prepare working aliquots that can be stored at 4°C for up to one week to minimize freeze-thaw cycles .

  • Freeze-thaw cycles: Repeated freezing and thawing is strongly discouraged as it can lead to protein denaturation and loss of enzymatic activity .

These storage recommendations are designed to maintain the structural integrity and catalytic activity of the protease. Researchers should consider creating small working aliquots upon initial thawing to prevent unnecessary exposure to freeze-thaw cycles.

What experimental systems exist for studying HtpX activity?

While specific experimental systems for Sphingomonas wittichii HtpX homolog are not detailed in the provided search results, significant advances have been made with the E. coli homolog that can inform approaches for studying the S. wittichii protein. Researchers have developed:

  • In vivo model substrate system: A semiquantitative and convenient protease activity assay system has been established for E. coli HtpX, using a constructed model substrate called XMS1 (HtpX model substrate 1) .

  • Detection of differential activities: This system enables detection of differential protease activities among HtpX mutants carrying mutations in conserved regions .

  • Applicability to homologs: The methodology is potentially applicable for investigating the functions of HtpX homologs in other bacteria, which would include the Sphingomonas wittichii variant .

This experimental approach provides a foundation for researchers interested in characterizing the enzymatic activity of Sphingomonas wittichii Protease HtpX homolog through analogous model substrate development.

How does Protease HtpX contribute to the unique metabolic capabilities of Sphingomonas wittichii?

Sphingomonas wittichii RW1 is particularly notable for its ability to degrade polychlorinated dioxins, which are priority environmental pollutants worldwide . While the direct contribution of Protease HtpX to this degradative capacity has not been explicitly established in the available literature, several hypotheses can be proposed based on its functional role:

  • Membrane protein quality control: As a membrane protease involved in quality control, HtpX may help maintain the integrity of membrane-bound enzymes essential for dioxin degradation pathways under stress conditions .

  • Stress response mechanisms: Dioxin metabolism likely imposes oxidative and other stresses on S. wittichii cells. HtpX, as part of heat shock response systems (indicated by the prefix "htp" for high temperature protein), may play a role in managing protein damage caused by these metabolic stresses .

  • Regulatory functions: Proteases often serve regulatory functions by selectively degrading specific protein targets. HtpX might participate in regulating the expression or activity of enzymes involved in dioxin degradation.

Proteomic profiling studies of S. wittichii RW1 have shown changes in protein expression in response to growth on dibenzofuran (a surrogate for dioxin), highlighting the complex metabolic adaptations involved in dioxin degradation . Further proteomic analyses focusing specifically on membrane proteins and their quality control mechanisms could elucidate the precise role of HtpX in this process.

What approaches can be used for functional characterization of Sphingomonas wittichii Protease HtpX homolog?

Comprehensive functional characterization of Sphingomonas wittichii Protease HtpX homolog requires multiple complementary approaches:

  • Model substrate development: Following the strategy used for E. coli HtpX, researchers can design and construct model substrates specific for the S. wittichii enzyme. This approach would involve:

    • Identifying potential cleavage sites based on sequence analysis

    • Creating fusion proteins with reporter tags for detection

    • Validating substrate specificity through in vitro and in vivo assays

  • Proteomic identification of native substrates:

    • Comparative proteomics between wild-type and htpX knockout strains

    • Stable isotope labeling with amino acids in cell culture (SILAC) to track protein degradation

    • Identification of accumulated membrane proteins in htpX-deficient cells

  • Mutational analysis:

    • Site-directed mutagenesis of conserved catalytic residues

    • Creation of chimeric proteins between E. coli and S. wittichii HtpX to identify functional domains

    • Analysis of differential activity using the model substrate system

  • Expression response studies:

    • Transcriptomic and proteomic analyses under various stress conditions

    • Identification of co-regulated genes to place HtpX in regulatory networks

    • Study of expression changes during growth on different carbon sources, including dioxins

These approaches would collectively provide insights into the substrate specificity, enzymatic mechanism, physiological role, and regulatory context of S. wittichii Protease HtpX homolog.

What is the relationship between HtpX and other proteolytic systems in bacterial membrane protein quality control?

The relationship between HtpX and other proteolytic systems represents an important area for investigation in bacterial membrane protein quality control. Based on studies of the E. coli homolog and general principles of bacterial proteostasis:

  • Complementary systems: HtpX likely functions as part of a network of proteases that collectively maintain membrane protein quality. In E. coli, HtpX has been shown to have partially overlapping functions with other membrane proteases such as FtsH .

  • Hierarchical degradation: Membrane protein degradation often proceeds through a hierarchical process, with initial cleavage by one protease creating substrates for subsequent proteases. HtpX might function upstream or downstream of other proteolytic systems.

  • Stress-specific activation: Different proteolytic systems may be activated under specific stress conditions. HtpX, being a heat shock protein, may be particularly important during thermal stress, while other systems predominate under different stress conditions.

  • Substrate specificity overlap: The specificity of HtpX likely overlaps partially with other membrane proteases, providing redundancy in the quality control system to ensure robustness.

Understanding these relationships requires systematic studies of double and triple protease knockouts, as well as biochemical characterization of substrate preferences. Such studies would elucidate the specific niche occupied by HtpX within the broader context of bacterial membrane protein quality control.

How can researchers optimize the expression and purification of active Recombinant Sphingomonas wittichii Protease HtpX homolog?

Optimizing the expression and purification of active membrane proteases presents significant challenges. For Recombinant Sphingomonas wittichii Protease HtpX homolog, researchers should consider the following strategies:

  • Expression systems:

    • E. coli membrane-targeted expression: Using signal sequences to direct the protein to the E. coli membrane

    • Cell-free expression systems: Particularly those optimized for membrane proteins

    • Consideration of codon optimization: Adapting the S. wittichii sequence for the expression host

  • Solubilization and stabilization:

    • Selection of appropriate detergents for membrane protein extraction

    • Addition of stabilizing agents such as glycerol (as used in the commercial preparation)

    • Use of amphipols or nanodiscs to maintain native-like membrane environment

  • Purification strategy:

    • Affinity chromatography using tags that minimally impact activity

    • Size exclusion chromatography to separate aggregates

    • Activity-based purification steps to enrich for functional protein

  • Activity preservation:

    • Maintaining appropriate zinc concentrations throughout purification

    • Buffer optimization to preserve the native conformation

    • Storage in stabilizing conditions (50% glycerol, Tris-based buffer)

  • Validation of activity:

    • Development of activity assays using model substrates similar to those developed for E. coli HtpX

    • Structural analysis to confirm proper folding

This methodological approach should facilitate the production of active enzyme suitable for biochemical and structural studies.

What computational approaches can aid in understanding Sphingomonas wittichii Protease HtpX homolog function?

Computational methods offer powerful tools for predicting and analyzing the function of proteins like Sphingomonas wittichii Protease HtpX homolog:

  • Sequence analysis:

    • Multiple sequence alignment with HtpX homologs to identify conserved catalytic residues

    • Identification of putative transmembrane regions using programs like TMHMM or Phobius

    • Prediction of protein topology and orientation in the membrane

  • Structural modeling:

    • Homology modeling based on structures of related zinc metalloproteinases

    • Molecular dynamics simulations to understand membrane interactions

    • Docking studies to predict substrate binding modes

  • Systems biology approaches:

    • Network analysis to identify functional associations with other proteins

    • Genome context analysis to identify conserved gene neighborhoods

    • Transcriptomic data mining to identify co-expression patterns

  • Substrate prediction:

    • Identification of potential substrates based on known cleavage site preferences

    • Proteome-wide scanning for proteins with features similar to known substrates

    • Prediction of protein-protein interactions

  • Evolutionary analysis:

    • Phylogenetic profiling to understand the distribution and conservation of HtpX across bacterial species

    • Identification of co-evolving residues that may be functionally linked

These computational approaches can guide experimental design and provide testable hypotheses about HtpX function, substrate specificity, and physiological role in S. wittichii.

What quality control parameters should be assessed for Recombinant Sphingomonas wittichii Protease HtpX homolog?

Researchers working with Recombinant Sphingomonas wittichii Protease HtpX homolog should evaluate several quality control parameters to ensure reliable experimental results:

  • Purity assessment:

    • SDS-PAGE analysis to confirm size and purity

    • Mass spectrometry to verify protein identity and detect possible post-translational modifications

    • Absence of contaminating proteases that could confound activity assays

  • Functional verification:

    • Enzymatic activity using defined substrates

    • Metal content analysis to confirm proper zinc incorporation

    • Thermal stability assays to assess proper folding

  • Structural integrity:

    • Circular dichroism spectroscopy to assess secondary structure

    • Limited proteolysis to evaluate domain stability

    • Size exclusion chromatography to detect aggregation

  • Storage stability:

    • Activity retention after storage at recommended conditions (-20°C in 50% glycerol)

    • Effects of freeze-thaw cycles on activity

    • Shelf-life determination under various storage conditions

Maintaining rigorous quality control is essential for obtaining reproducible results in studies involving this membrane protease.

How can researchers design experiments to study the physiological role of HtpX in Sphingomonas wittichii?

To elucidate the physiological role of HtpX in Sphingomonas wittichii, researchers should consider a multi-faceted experimental approach:

  • Genetic manipulation:

    • Generation of htpX knockout strains

    • Complementation studies with wild-type and mutant variants

    • Construction of conditional expression systems for titrating HtpX levels

  • Phenotypic characterization:

    • Growth curves under various stress conditions (heat, oxidative stress, membrane-disrupting agents)

    • Assessment of dioxin degradation capabilities in wild-type versus htpX mutant strains

    • Membrane integrity assays to evaluate quality control function

  • Global analyses:

    • Transcriptomics to identify genes differentially expressed in response to HtpX deletion

    • Proteomics to identify accumulated substrates in htpX mutants

    • Metabolomics to detect changes in metabolic pathways

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify interaction partners

    • Bacterial two-hybrid screening for protein interactions

    • Cross-linking studies to capture transient interactions

  • In vivo activity monitoring:

    • Development of fluorescent reporter systems for HtpX activity

    • Real-time monitoring of substrate degradation

    • Localization studies to confirm membrane integration

This comprehensive approach would provide insights into the physiological functions of HtpX in Sphingomonas wittichii and its potential role in the organism's unique metabolic capabilities.

What are the future research directions for understanding Sphingomonas wittichii Protease HtpX homolog?

Future research on Sphingomonas wittichii Protease HtpX homolog should address several key questions:

  • Substrate identification: Determining the physiological substrates of HtpX in S. wittichii through proteomics approaches comparing wild-type and htpX knockout strains under various growth conditions.

  • Structure-function relationships: Resolving the three-dimensional structure of S. wittichii HtpX to understand its catalytic mechanism and substrate binding sites.

  • Role in stress response: Investigating the specific contribution of HtpX to various stress responses, particularly those relevant to the organism's environmental niche and xenobiotic degradation capabilities.

  • Regulatory networks: Elucidating how HtpX expression and activity are regulated in response to environmental signals and stressors.

  • Biotechnological applications: Exploring potential applications of HtpX in biotechnology, such as engineered proteolytic systems for specific applications or improved bioremediation capabilities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.