Recombinant Sphingomonas wittichii UPF0391 membrane protein Swit_2334 (Swit_2334)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery times may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
While we determine the tag type during production, we are open to developing specified tags. Please communicate your desired tag type, and we will prioritize its implementation.
Synonyms
Swit_2334; UPF0391 membrane protein Swit_2334
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-60
Protein Length
full length protein
Species
Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)
Target Names
Swit_2334
Target Protein Sequence
MLKWALIFLVVGLVLGALGFGGIGGAFVGLAKILFFIAIALFIVFALLALFAGKKISDSI
Uniprot No.

Target Background

Database Links
Protein Families
UPF0391 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the structural characterization of the Sphingomonas wittichii UPF0391 membrane protein Swit_2334?

    Swit_2334 is a 60-amino acid membrane protein from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) with UniProt accession number A5V8S7. Its amino acid sequence is mLKWALIFLVVGLVLGALGFGGIGGAFVGLAKILFFIAIALFIVFALLALFAGKKISDSI, which indicates a highly hydrophobic transmembrane structure . The protein belongs to the UPF0391 family, a group of uncharacterized proteins with potential membrane-associated functions. Structural analyses suggest it contains transmembrane helices consistent with its role as an integral membrane protein.

  • What is the genomic context of Swit_2334 in the Sphingomonas wittichii RW1 genome?

    Swit_2334 is positioned within a specific region of the S. wittichii RW1 genome. According to IslandPath analysis, it is located in a genomic context with distinctive G+C content characteristics. The protein-coding gene is surrounded by several other genes including those encoding metabolic enzymes and hypothetical proteins . The genomic neighborhood of Swit_2334 includes genes like Swit_2333 and Swit_2335, which may have functional relationships with Swit_2334 based on their proximity and potential co-regulation patterns. The genomic context analysis indicates it may be part of a functional gene cluster involved in membrane-associated processes.

  • How does Swit_2334 expression change under different environmental conditions?

    Transcriptomic analysis has revealed that Swit_2334 expression is significantly upregulated (16.0-fold increase) under specific environmental stress conditions . Studies have shown that the expression of this membrane protein varies depending on growth conditions, particularly in response to water stress and exposure to aromatic pollutants like dibenzofuran. When S. wittichii RW1 is grown in contaminated environments, Swit_2334 shows distinctive expression patterns compared to growth under standard laboratory conditions, suggesting its potential role in adaptation to environmental stressors or xenobiotic compounds .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.