Recombinant Sphingomyelin synthase-related 1 (F53B1.2)

Shipped with Ice Packs
In Stock

Description

Research Applications

Recombinant F53B1.2 is utilized in:

ApplicationDescription
Western Blot (WB)Detects F53B1.2 expression in C. elegans lysates using rabbit polyclonal antibodies .
ELISAQuantifies F53B1.2 protein levels in biochemical assays .
Enzymatic AssaysStudies PE-PLC and CPE synthase activities, contrasting with SMS1/SMS2’s PC-PLC/SM synthase roles .
Antigen ProductionServes as an immunogen for generating anti-F53B1.2 antibodies .

Distinct Enzymatic Profile

Unlike SMS1/SMS2, F53B1.2:

  • Lacks SM Synthesis: No phosphatidylcholine (PC):ceramide phosphocholine transferase activity .

  • PE-PLC/CPE Synthase Activity: Hydrolyzes PE or transfers ethanolamine to ceramide, producing CPE .

Role in Lipid Metabolism

  • CPE Synthesis: CPE is a trace lipid with roles in membrane structure and signaling .

  • ER Lipid Dynamics: SMS-related proteins (including F53B1.2) influence ER lipid composition, potentially affecting membrane biogenesis .

Contrast with SMS1/SMS2

FeatureF53B1.2 (SMSr)SMS1/SMS2
LocalizationERGolgi/Plasma Membrane
Primary ActivityPE-PLC/CPE synthasePC-PLC/SM synthase
SubstratesPE, ceramidePC, ceramide
ProductsDAG, CPESM, DAG

Implications for Disease and Cellular Biology

While F53B1.2 itself is not directly implicated in human diseases, its study informs broader lipid metabolism pathways:

  • ER Lipid Imbalance: Dysregulation of ER-resident enzymes (e.g., SMSr) may disrupt lipid gradients, affecting organelle function .

  • CPE’s Role: CPE, synthesized by F53B1.2, may modulate membrane curvature or signaling, though its physiological relevance remains under investigation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
F53B1.2; Sphingomyelin synthase-related 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-483
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
F53B1.2
Target Protein Sequence
MLDNRPIPADPNEWRCEDVGNWLKKIGMAKYADLIAMKHKVDGKCLLALTDTDLKDPPVS INCLGDIKKILFAIEFLSQKVVEIGNSGVHHRSTPNGNGPSLKNSKDGLLVEYNEQNHLS ISGEDVYTTTRRAEIVEDEETLLDTLAKSSDGTSTVQLISREEIIRQVERPDTYFKSVAK LLIAFAYSSLSFLMTSFVMVLVHDRVPDTKTYPPLPDIVLDNVPHIPWAFDMCETIGLVL AVVWFTVLFFHNQRVIVARRMFSLLGTVFLLRCFTMLITSLSVPGIHLQCEARPNTTMQE KLHKAFHIWSNLGMSLHGVRSCGDYMFSGHTTVITMISHFITEYTPADWTGLHTFTWVLN CFAIFLILAAHEHYSIDVFIAFYISSRMFLYYHAYAYNHAGITATDYRMRTWFPLGWFFE YGSQGKVENEFSLPINIRIPRRVFFAKSEEPKITPKSDSSRKRSSVVAAKQNGNSKNHTK KHN
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_F53B1.2

STRING: 6239.F53B1.2

UniGene: Cel.7215

Protein Families
Sphingomyelin synthase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Sphingomyelin synthase-related 1 (F53B1.2) and how does it relate to other SMS family members?

F53B1.2 appears to be one of the sphingomyelin synthase-related proteins in Caenorhabditis elegans. The SMS family in C. elegans comprises five members (including SMSα, SMSβ, SMSγ, and SMSr), while mammals possess three members: SMS1, SMS2, and SMS-related protein (SMSr). Based on functional studies, F53B1.2 likely corresponds to SMSr in C. elegans, which belongs to a conserved family of enzymes involved in sphingolipid metabolism .

Mammalian SMS1 and SMS2 catalyze the transfer of phosphocholine from phosphatidylcholine (PC) onto ceramide to form sphingomyelin (SM), while SMSr has no SMS activity but can transfer phosphoethanolamine from phosphatidylethanolamine (PE) onto ceramide to form ceramide phosphoethanolamine (CPE) in vitro .

What enzymatic activities are associated with SMS family proteins?

SMS family proteins exhibit multiple enzymatic activities that contribute to lipid homeostasis:

  • SM synthase activity: Transfer of phosphocholine from PC to ceramide, producing SM and diacylglycerol (DAG) .

  • Phospholipase C activity: SMS1 and SMS2 demonstrate PC-PLC activity, hydrolyzing PC to generate DAG and phosphocholine in the absence of ceramide .

  • PE-PLC activity: SMSr exhibits significant PE-PLC activity but little to no SM synthase activity .

These dual enzymatic capabilities position SMS family members as potential regulators of both sphingolipid and glycerolipid metabolism pathways, influencing cellular signaling through modulation of ceramide and DAG levels .

What expression systems are effective for producing recombinant F53B1.2 protein?

Several expression systems have proven effective for producing functional recombinant SMS family proteins:

  • Insect cell expression: Induction of recombinant SMS protein expression using 1 mM CuSO4 for 3 hours followed by a 2-hour chase period .

  • Mammalian cell expression: Transfection of Cos7 cells with expression vectors containing tagged SMS constructs (e.g., FLAG-tagged or V5-tagged) .

  • Expression in SMS-deficient backgrounds: Transfection of HeLa SMS1/2 double knockout cells to eliminate background SMS activity when characterizing novel SMS proteins .

For optimal purification and detection, epitope tagging (FLAG, V5) of recombinant proteins is recommended, allowing for immunoprecipitation and subsequent activity assays .

What established methods can measure SMS enzymatic activity reliably?

Several complementary approaches can assess SMS enzymatic activity:

MethodSubstrate(s)Output MeasurementAdvantage
SMS Activity AssayPC + NBD-ceramideNBD-SM formationSpecific for SM synthase activity
PC-PLC Activity AssayNBD-PC (no ceramide)NBD-DAG productionIsolates phospholipase activity
Metabolic Labeling[14C]-serineLabeled sphingolipids (TLC analysis)Allows tracking of metabolic flux
Direct P-choline MeasurementPCReleased phosphocholineQuantifies hydrolysis product
Lipidomic AnalysisN/AChanges in SM, PC, DAG levelsComprehensive lipid profile

For highest specificity, researchers should employ immunoprecipitation of tagged SMS proteins to eliminate interference from endogenous enzymes .

How can I distinguish between SMS and PC-PLC activities experimentally?

Differentiating between these related enzymatic activities requires careful experimental design:

What controls should be included when characterizing F53B1.2 function?

Proper controls are essential for reliable characterization of F53B1.2:

  • Positive controls: Include well-characterized SMS family members (e.g., human SMS1) in parallel experiments .

  • Negative controls: Empty vector transfections and enzymatically inactive mutants .

  • Background elimination: Use SMS1/2-deficient cell lines to eliminate endogenous SM synthase activity that might mask subtle effects .

  • Cross-validation: Employ multiple analytical techniques (enzymatic assays, metabolic labeling, lipidomics) to confirm observations .

  • Substrate controls: Include alternative substrates (e.g., NBD-PE) to assess enzyme specificity .

How do F53B1.2 and other SMS family members influence cellular lipid homeostasis?

SMS family proteins significantly impact cellular lipid homeostasis through multiple mechanisms:

  • Direct enzymatic effects:

    • SMS activity converts ceramide to SM, simultaneously generating DAG

    • PC-PLC activity hydrolyzes PC to produce DAG and phosphocholine

  • Steady-state lipid regulation: Studies in SMS-deficient mice demonstrate that SMS1/SMS2 deficiency influences steady-state levels of PC and DAG in the liver. Liver-specific SMS1/global SMS2 double-knockout mice showed altered lipid profiles compared to control mice .

  • Lipidome-wide effects: Lipidomic analysis of cells expressing different SMS family members revealed that:

    • hsSMS1 expression in SMS1/2-/- cells increased total SM levels approximately 7-fold

    • ceSMSα expression increased SM levels approximately 8-fold

    • ceSMSβ expression increased SM levels approximately 2.5-fold

    • Minor alterations in other lipid classes were observed, including slight increases in PC and PE, coupled with mild but consistent reductions in triacylglycerol (TAG) .

What is known about the substrate specificity of SMS family members?

SMS family members demonstrate distinct substrate preferences:

  • Head group specificity:

    • SMS1 and SMS2 primarily transfer phosphocholine from PC to ceramide

    • SMSr transfers phosphoethanolamine from PE to ceramide

  • Lipid substrate specificity:

    • SMS1 and SMS2 have substantial PC-PLC activity but extremely weak or no PE-PLC activity

    • SMSr exhibits high PE-PLC activity consistent with its in vitro CPE synthase activity

  • Enzymatic efficiency:

    • rSMS2 demonstrates higher PC-PLC activity than rSMS1 when equivalent amounts of recombinant protein are used

    • Both proteins produce phosphocholine, with SMS2 showing higher activity

How does cellular transformation affect SMS activity and expression?

Cellular transformation appears to significantly alter SMS activity and metabolism:

  • Activity enhancement: SV40-transformed human lung fibroblasts (WI38) exhibit substantially higher SMS activity (222 pmol/mg protein/h) compared to wild-type cells (78 pmol/mg protein/h) .

  • Ceramide clearance: Transformed cells clear ceramide much more efficiently:

    • Normal WI38 cells clear 17% of [3H]C2-ceramide after 24 hours

    • SV40-transformed cells clear 45% of [3H]C2-ceramide in the same period

  • SM regeneration after SMase treatment:

    • Wild-type cells clear ceramide slowly (19.2 pmol ceramide/nmol phospholipid Pi after 6 hours) with minimal SM regeneration

    • Transformed cells clear ceramide rapidly (41.1 pmol/nmol Pi after 6 hours) and regenerate approximately 80% of the original SM

These findings suggest that SMS activity may be upregulated during cellular transformation, potentially contributing to transformed cell phenotypes through altered lipid signaling.

How should lipidomic data be interpreted to assess F53B1.2 function?

Comprehensive interpretation of lipidomic data requires attention to multiple parameters:

  • Primary SMS products: Monitor SM levels as direct indicators of SMS activity. In heterologous expression systems, functional SMS enzymes can increase SM levels 2.5-8 fold compared to control cells .

  • Substrate changes: Track PC levels as the primary phospholipid substrate for SMS activity.

  • Metabolic connections: Analyze related lipids including ceramide, DAG, PE, and TAG, which may show secondary changes due to metabolic interconnections.

  • Acyl chain profiles: Examine the distribution of acyl chain species within each lipid class, as SMS enzymes may show preferences for specific molecular species.

  • Comparative analysis: When analyzing lipidomes of cells expressing different SMS family members, similar patterns of lipid enrichment between human SMS1 and C. elegans SMSα and SMSβ suggest functional conservation .

What technical challenges must be addressed when studying F53B1.2?

Several technical challenges must be overcome for reliable F53B1.2 characterization:

  • Background enzymatic activities: Other enzymes can influence the detection of enzymatic products. For example, weak NBD-DAG signals may be detected even in control samples due to other enzymatic activities .

  • Substrate availability and presentation: The physical state and accessibility of lipid substrates can significantly affect enzymatic activity measurements.

  • Enzymatic specificity: Careful distinction between different enzymatic activities (SMS, PC-PLC, PE-PLC) requires specific substrates and controls.

  • Inhibitor specificity: D609 (tricyclodecan-9-yl-potassium xanthate), previously considered a PC-PLC-specific inhibitor, also inhibits SMS activity, complicating interpretation of inhibitor studies .

  • In vitro versus in vivo activity: Although changes in PC and DAG levels observed in SMS knockout mice align with PC-PLC activity detected in vitro, further work is necessary to determine the extent to which these changes are truly mediated by PC-PLC activity in vivo .

How conserved are SMS functions across different model organisms?

SMS functions show significant evolutionary conservation with species-specific adaptations:

  • Functional conservation: Both mammalian SMS1 and C. elegans SMSα and SMSβ support SM production when expressed in heterologous systems, demonstrating conservation of core enzymatic function .

  • Family expansion: While mammals possess three SMS family members (SMS1, SMS2, SMSr), C. elegans contains five SMS homologues, suggesting potential functional diversification in nematodes .

  • Enzymatic activities: The dual functions (SM synthase and phospholipase C activities) appear to be conserved features of SMS family proteins across species .

  • Cellular roles: SMS enzymes in both mammals and C. elegans regulate lipid homeostasis, particularly affecting the levels of sphingolipids and glycerolipids that participate in both structural and signaling functions .

What can be learned from comparing F53B1.2 with its homologues in mammals?

Comparative analysis of F53B1.2 with mammalian homologues provides important insights:

  • Functional equivalence: Expression of ceSMSα and ceSMSβ in mammalian SMS1/2-deficient cells restores SM production, with lipid profiles resembling those of cells expressing human SMS1, indicating functional conservation across species .

  • Substrate utilization: Both mammalian and C. elegans SMS family members demonstrate specific headgroup preferences and acyl chain preferences in their enzymatic activities .

  • Evolutionary adaptation: The expansion of the SMS family in C. elegans suggests potential adaptation to nematode-specific lipid metabolism requirements or developmental programs .

  • Regulatory mechanisms: Differences in SMS regulation between species may inform our understanding of sphingolipid metabolism control across evolution.

What are the implications of F53B1.2 dual enzymatic activities for cell biology?

The dual enzymatic capabilities of SMS family proteins have significant implications:

  • Lipid signaling hub: By modulating levels of multiple bioactive lipids (ceramide, DAG, SM), SMS enzymes can influence diverse signaling pathways simultaneously .

  • Metabolic integration: SMS activity represents a point of convergence between sphingolipid and glycerolipid metabolism, potentially coordinating these pathways .

  • Cell transformation: Enhanced SMS activity in transformed cells suggests a potential role in cancer biology, possibly by altering ceramide-mediated apoptotic signaling .

  • Therapeutic target: The inhibition of SMS by D609, which was previously attributed to PC-PLC inhibition, suggests SMS as a potential therapeutic target that might be leveraged for disease intervention .

What methodological advances would enhance F53B1.2 research?

Several technological and methodological advances would significantly benefit F53B1.2 research:

  • Structure-function analysis: Determination of the three-dimensional structure of SMS family proteins would provide insights into the molecular basis of their dual enzymatic activities.

  • Tissue-specific knockout models: Development of tissue-specific and inducible knockout models in C. elegans would allow for precise temporal and spatial analysis of F53B1.2 function.

  • Specific inhibitors: Design of selective inhibitors that can distinguish between SMS and PC-PLC activities would facilitate functional studies.

  • Single-cell lipidomics: Application of emerging single-cell lipidomic technologies would reveal cell-to-cell variability in sphingolipid metabolism.

  • Interactome analysis: Identification of protein-protein interactions involving F53B1.2 would provide context for understanding its cellular functions beyond enzymatic activities.

How might F53B1.2 contribute to nematode development and physiology?

While specific developmental roles of F53B1.2 in C. elegans require further investigation, several potential contributions can be hypothesized based on current knowledge:

  • Membrane structure: As an enzyme involved in sphingolipid metabolism, F53B1.2 likely contributes to membrane organization and function during development.

  • Cell signaling: By modulating levels of signaling lipids like ceramide and DAG, F53B1.2 may influence developmental signaling pathways.

  • Stress responses: Sphingolipid metabolism is known to play roles in cellular stress responses, suggesting F53B1.2 might contribute to stress adaptation in nematodes.

  • Nervous system function: Given that SM is particularly abundant in the myelin sheath surrounding nerve fibers in mammals, SMS family proteins might have specialized functions in the nematode nervous system .

What are common pitfalls in recombinant F53B1.2 expression and purification?

Researchers should be aware of several common challenges:

  • Protein folding and stability: As a membrane protein, F53B1.2 may require specific conditions for proper folding and stability.

  • Background activities: Endogenous SMS activities in expression systems can confound results, necessitating the use of SMS-deficient backgrounds or immunopurification strategies .

  • Substrate presentation: The physical state of lipid substrates (micelles, vesicles, etc.) can significantly impact enzymatic activity measurements.

  • Activity verification: Multiple complementary assays should be employed to confirm enzymatic activities, as single assays may be affected by interfering factors .

  • Expression levels: Optimization of expression conditions is critical, as demonstrated by the successful induction protocol using 1 mM CuSO4 for 3 hours followed by a 2-hour chase .

How can I verify the specificity of observed F53B1.2 activities?

Verification of enzymatic specificity requires multiple approaches:

  • Substrate panel testing: Assess activity with various substrates (PC, PE, other phospholipids) to determine specificity .

  • Product verification: Confirm the identity of reaction products using multiple analytical techniques (TLC, mass spectrometry) .

  • Kinetic analysis: Determine Michaelis-Menten parameters under various conditions to characterize enzymatic behavior .

  • Genetic complementation: Express F53B1.2 in SMS-deficient cells to determine if it can restore specific lipid profiles .

  • Inhibitor studies: Use known inhibitors like D609 to assess sensitivity patterns characteristic of SMS family proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.