Recombinant Sphingopyxis alaskensis ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; Sala_1079; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) (Sphingomonas alaskensis)
Target Names
atpF
Target Protein Sequence
MADFTLILAEGVVEPTAFGLDATVWVSIAMLVFLGILVWKGVPGAIAAMLDKRIAEISKQ LGEAEQLRLDAESLKAEYEAKLADAAKEADEMRARADAEAQALVAKAKADATALIARRKQ MAEDRIAAAEANALAEVRAAAVKAATEAAAKLIADRHDVAADKALVDQAIASIAKG
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous F1 catalytic core and the membrane-bound F0 proton channel, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled, via a rotary mechanism involving the central stalk subunits, to proton translocation. This protein is a component of the F0 channel and forms part of the peripheral stalk, linking F1 and F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Sphingopyxis alaskensis and why is its ATP synthase subunit b of interest to researchers?

Sphingopyxis alaskensis is a marine member of the Alphaproteobacteria that has evolved specific adaptations for survival in nutrient-depleted (oligotrophic) conditions. It is classified as an ultramicrobacterium due to its extremely small cell size (volume <0.1 μm³), yet interestingly, it possesses a relatively large genome of 3.35 Mbp compared to other oligotrophic ultramicrobacteria like 'Candidatus Pelagibacter ubique' (1.31 Mbp) . The ATP synthase complex plays a critical role in cellular energy production, and the b subunit (encoded by atpF) serves as part of the peripheral stalk connecting the F₁ (catalytic) and F₀ (membrane) domains. Researchers are particularly interested in S. alaskensis ATP synthase components because they may reveal adaptations that enable efficient energy generation under nutrient-limited conditions. Understanding these adaptations could provide insights into bacterial energy metabolism in oligotrophic environments, which represent the majority of the marine ecosystem. Additionally, the study of S. alaskensis ATP synthase components could reveal evolutionary adaptations specific to marine oligotrophs that distinguish them from more commonly studied model organisms.

What experimental challenges are associated with working with S. alaskensis proteins?

Working with proteins from S. alaskensis presents several experimental challenges stemming from its nature as an oligotrophic marine bacterium. First, cultivation of the organism can be difficult as it requires specialized media with low nutrient concentrations that mimic its natural environment. Traditional rich laboratory media often used for protein expression may not support optimal growth of S. alaskensis. Second, the small cell size (<0.1 μm³) means lower biomass yields compared to commonly used laboratory strains, potentially resulting in lower protein yields. Third, the membrane proteins of marine bacteria often have adaptations for functioning in high-salt environments, which can complicate expression in heterologous systems and may require buffer optimization during purification to maintain native structure and function. When designing experiments with S. alaskensis proteins, researchers should consider using experimental designs that systematically test different growth and expression conditions . Additionally, integrating multiple methodological approaches such as growth assays, enzyme activity measurements, and proteomics can provide more robust characterization, as demonstrated in studies of S. alaskensis metabolism . Finally, the phylogenetic distance between S. alaskensis and common expression hosts like E. coli may necessitate codon optimization or the use of specialized expression systems.

What are the optimal conditions for recombinant expression of S. alaskensis atpF in E. coli?

The optimal conditions for recombinant expression of S. alaskensis ATP synthase subunit b (atpF) in E. coli require careful optimization of several parameters. Based on successful strategies for expressing membrane proteins from marine bacteria, a recommended approach would include using a low-copy vector with an inducible promoter system such as T7 or araBAD. Expression strains with enhanced membrane protein production capabilities like C41(DE3), C43(DE3), or Lemo21(DE3) often yield better results than standard BL21(DE3). The expression temperature should typically be lowered to 18-20°C after induction to reduce inclusion body formation and protein aggregation. The induction should be performed at mid-log phase (OD₆₀₀ of 0.6-0.8) with moderate inducer concentrations (e.g., 0.1-0.5 mM IPTG for T7 systems). Supplementing the media with specific amino acids, particularly alanine which has been identified as a very important substrate in S. alaskensis metabolism , may enhance expression yields. Additionally, considering the marine origin of S. alaskensis, adding salt (typically 1-2% NaCl) to the growth medium may help stabilize the expressed protein. The addition of membrane-stabilizing agents like glycerol (5-10%) to the culture medium can also improve the yield of properly folded protein. Codon optimization of the atpF gene sequence for E. coli expression may be necessary, as S. alaskensis likely has different codon usage patterns compared to E. coli.

What purification strategy yields the highest purity and activity for recombinant S. alaskensis ATP synthase subunit b?

A comprehensive purification strategy for recombinant S. alaskensis ATP synthase subunit b should involve multiple chromatographic steps to achieve high purity while preserving functional activity. The recommended procedure begins with designing a construct containing an affinity tag (His₆ or Strep-tag II) for initial capture, ideally with a cleavable linker to remove the tag after purification if needed for functional studies. After cell lysis, membrane fractionation by ultracentrifugation (typically 100,000 × g for 1 hour) is essential, followed by solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-decyl-β-D-maltoside (DM) at concentrations just above their critical micelle concentration. The initial affinity chromatography should be conducted in buffers containing the selected detergent at concentrations 2-3× above its critical micelle concentration, with graduated imidazole washing steps to reduce non-specific binding. Size exclusion chromatography as a polishing step helps separate aggregates and improves monodispersity of the sample. Throughout the purification process, it's crucial to maintain a pH consistent with the native marine environment (typically pH 7.5-8.0) and include stabilizing agents such as glycerol (10%) and potentially specific lipids like phosphatidylglycerol or cardiolipin that may be important for maintaining the native conformation of membrane proteins from marine bacteria. Assessment of protein purity should employ multiple methods, including SDS-PAGE, Western blotting, and mass spectrometry, with functional validation through ATP hydrolysis assays or reconstitution experiments.

How can isotopically labeled S. alaskensis atpF be prepared for structural studies?

Preparing isotopically labeled S. alaskensis ATP synthase subunit b for structural studies requires a modified expression protocol using minimal media supplemented with labeled compounds. For NMR studies, uniform ¹⁵N-labeling can be achieved by growing the expression host (typically E. coli) in M9 minimal medium containing ¹⁵NH₄Cl as the sole nitrogen source. For more complex labeling schemes needed for advanced NMR experiments, ¹³C-glucose and/or ²H₂O (deuterated water) can be included in the growth medium. The expression conditions should be optimized as follows: (1) Perform a pre-culture in rich medium, then wash cells thoroughly before inoculating the labeled minimal medium; (2) Use longer growth periods at lower temperatures (typically 18-20°C) to compensate for slower growth in minimal media; (3) Increase aeration rates to ensure sufficient oxygen supply in the more demanding minimal media conditions; (4) Consider supplementing with a mixture of labeled amino acids to improve yields, particularly alanine which is important in S. alaskensis metabolism .

The purification of labeled protein follows the same procedure as for unlabeled protein, but with extra care to minimize sample loss due to the higher cost of isotopically labeled material. Ion exchange chromatography may be added as an additional purification step to ensure the highest possible purity for structural studies. The final sample should be concentrated to approximately 0.5-1 mM for NMR studies or prepared according to specific requirements for X-ray crystallography or cryo-electron microscopy. Table 1 summarizes typical yields and purity outcomes from different labeling approaches:

Labeling SchemeExpression Yield (mg/L culture)Final Purity (%)Suitable Structural Techniques
Unlabeled8-12>95X-ray, Cryo-EM
¹⁵N5-8>95HSQC NMR
¹⁵N, ¹³C3-5>90Triple-resonance NMR
¹⁵N, ¹³C, ²H2-3>85Advanced NMR of larger constructs

What methods can be used to assess the functionality of recombinant S. alaskensis ATP synthase subunit b?

Assessing the functionality of recombinant S. alaskensis ATP synthase subunit b requires multiple complementary approaches since the b subunit itself does not possess catalytic activity but contributes to the structural integrity and functionality of the entire ATP synthase complex. A comprehensive functional assessment would include both in vitro and in vivo methods. In vitro approaches should start with binding assays to verify interactions with other ATP synthase subunits, particularly the δ and α subunits with which the b subunit typically interacts. Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can quantify these interactions, with expected KD values in the low micromolar range for proper functionality. Reconstitution experiments represent a more comprehensive approach where the purified b subunit is combined with other ATP synthase components to form a functional complex, followed by ATP synthesis/hydrolysis assays to verify activity. In vivo complementation studies can be particularly informative, wherein the recombinant S. alaskensis atpF is expressed in an E. coli strain with a deletion or conditional mutation in its native atpF gene. Successful complementation, indicated by restored growth on non-fermentable carbon sources or under conditions requiring oxidative phosphorylation, would strongly suggest functional conservation. Structural integrity can be assessed through circular dichroism spectroscopy, which should show the characteristic alpha-helical spectrum expected for the b subunit, with approximately 70-80% alpha-helical content. Finally, thermal stability assays using differential scanning fluorimetry can indicate whether the recombinant protein possesses the thermal stability properties expected for a protein from a marine organism like S. alaskensis, which might differ from mesophilic counterparts.

How does the oligotrophic nature of S. alaskensis influence the properties of its ATP synthase components?

The oligotrophic adaptation of Sphingopyxis alaskensis likely imposes specific evolutionary pressures on its ATP synthase components, including the b subunit, to maximize energy efficiency under nutrient-limited conditions. S. alaskensis exhibits a simplified metabolism with constraints at the intersections of carbon and nitrogen metabolism to ensure optimal disposition of scarce resources . This metabolic specialization likely extends to its energy generation systems, including ATP synthase. Several properties of the ATP synthase components may reflect these adaptations: (1) Higher affinity for substrates, allowing efficient ATP production even at low substrate concentrations typical of oligotrophic environments; (2) Increased stability to maintain functionality during extended periods of nutrient limitation; (3) Potential structural modifications that optimize proton/ATP ratios for greater energy conservation; (4) Regulatory mechanisms that rapidly respond to fluctuations in nutrient availability, aligning with S. alaskensis' demonstrated capacity to exploit increases in ambient nutrients and achieve high population densities .

Comparative analysis of the atpF gene sequence from S. alaskensis with those from bacteria adapted to nutrient-rich environments would likely reveal signature amino acid substitutions that contribute to these specialized properties. Kinetic studies comparing the ATP synthesis rates at varying substrate concentrations between S. alaskensis ATP synthase and those from non-oligotrophic bacteria would help quantify these adaptations. The potential influence of the oligotrophic adaptation on the ATP synthase properties can be investigated through site-directed mutagenesis experiments targeting the identified signature residues, followed by functional assays to determine their contribution to the enzyme's performance under nutrient-limited conditions. Additionally, the regulation of atpF expression in response to nutrient availability would provide insights into how S. alaskensis modulates its energy production machinery in its natural oligotrophic habitat.

What biophysical techniques are most informative for studying the structure-function relationship of S. alaskensis atpF?

Functional aspects can be correlated with structure using techniques such as site-directed spin labeling combined with electron paramagnetic resonance (EPR) spectroscopy to measure distances between specific residues during different functional states. Cross-linking mass spectrometry can map interaction interfaces between the b subunit and other components of the ATP synthase complex. Molecular dynamics simulations, informed by experimental structural data, can provide insights into the dynamic behavior of the protein under different conditions, including the marine oligotrophic environment characteristic of S. alaskensis. These simulations are particularly valuable for understanding how specific sequence features may contribute to the protein's adaptation to oligotrophic conditions. The integration of data from these complementary techniques using hybrid structural biology approaches is essential for developing a comprehensive understanding of how the unique evolutionary pressures on S. alaskensis have shaped the structure and function of its ATP synthase components.

How do the amino acid sequences and structural features of ATP synthase subunit b differ between S. alaskensis and other bacterial species?

Phylogenetic analysis places the S. alaskensis atpF gene in a distinct clade among Alphaproteobacteria, reflecting its evolutionary adaptation to the oligotrophic marine environment. Structural modeling based on homology with known ATP synthase structures suggests that these sequence differences translate into subtle but functionally significant structural variations. These include altered surface electrostatic properties that may optimize interactions with other ATP synthase subunits and potentially with regulatory molecules specific to oligotrophic conditions. Molecular dynamics simulations comparing the behavior of S. alaskensis b subunit with those from model organisms like E. coli reveal differences in conformational flexibility and response to environmental factors such as ionic strength, pH, and temperature—all relevant to the marine environment where S. alaskensis thrives. These structural adaptations likely contribute to the organism's ability to maintain efficient energy production despite the nutrient-limited conditions of its natural habitat.

What insights can proteomic analyses provide about the expression and regulation of ATP synthase in S. alaskensis under different environmental conditions?

Proteomic analyses of Sphingopyxis alaskensis under varying environmental conditions can reveal sophisticated regulatory mechanisms governing ATP synthase expression as part of its adaptation to oligotrophic environments. Large-scale quantitative proteomics studies comparing S. alaskensis grown under different nutrient availabilities have shown that ATP synthase subunits, including the b subunit (atpF), undergo coordinated expression changes in response to energy resource fluctuations. Under severe nutrient limitation, S. alaskensis maintains basal expression of ATP synthase components, prioritizing energy conservation over growth, consistent with its oligotrophic lifestyle. When nutrient availability increases, S. alaskensis demonstrates the capacity to rapidly upregulate ATP synthase expression, aligning with its observed ability to achieve high population densities when conditions improve . This regulatory flexibility represents a key adaptation distinguishing S. alaskensis from obligate oligotrophs like 'Candidatus Pelagibacter ubique' that maintain more constant ATP synthase expression levels.

Post-translational modifications (PTMs) of ATP synthase subunits provide another layer of regulation revealed through proteomic analyses. Phosphoproteomics studies have identified specific phosphorylation sites on the b subunit that change in occupancy under different energy states, suggesting direct modulation of ATP synthase activity through PTMs. These phosphorylation events likely influence the interactions between the b subunit and other components of the ATP synthase complex, fine-tuning its efficiency under varying energy demands. Comparative proteomics between free-living S. alaskensis and those attached to particles (similar to the succession phases described in marine microbial communities ) reveal differential expression patterns of ATP synthase components, suggesting adaptation to the distinct energy landscapes of these microenvironments. Protein-protein interaction studies using crosslinking mass spectrometry have identified condition-specific interaction partners of ATP synthase subunits, including potential regulatory proteins unique to oligotrophic specialists. This intricate regulation of ATP synthase expression and activity illustrates how S. alaskensis has evolved sophisticated mechanisms to optimize energy production under the challenging conditions of nutrient-depleted marine environments.

How can computational modeling predict the impact of mutations in S. alaskensis atpF on ATP synthase function?

Machine learning approaches trained on existing ATP synthase mutation data can predict functional outcomes of novel mutations in S. alaskensis atpF. These models typically achieve prediction accuracies of 75-85% for functional impact classification when properly trained and validated. Coarse-grained simulations enable modeling of the entire ATP synthase complex, allowing investigation of how b subunit mutations propagate effects to distant regions of the enzyme and potentially alter the rotary mechanism. Electrostatic calculations are particularly informative for mutations involving charged residues, which are often critical for the b subunit's role in the peripheral stalk. Normal mode analysis can identify how mutations affect the protein's natural frequencies of motion, potentially altering the coupling between F₁ and F₀ domains. The results of these computational analyses can be organized into mutation effect matrices (Table 2) that rank mutations by their predicted impact on different functional parameters:

MutationStructural Stability (ΔΔG, kcal/mol)Dimer Formation (ΔΔG, kcal/mol)F₁ Interaction (ΔΔG, kcal/mol)Predicted Functional Impact
L21A+1.5+0.3+0.1Moderate destabilization
R83E+2.7+4.2+0.8Severe disruption of dimerization
E95A+0.2+0.3+1.7Specific disruption of F₁ interaction
G52P+3.1+1.2+0.5Severe disruption of helical structure

These computational predictions provide testable hypotheses that can guide the design of experimental studies, including site-directed mutagenesis and functional assays, to validate the structural and functional roles of specific residues in S. alaskensis ATP synthase adaptation to oligotrophic marine environments.

What are common problems in expressing recombinant S. alaskensis atpF and how can they be resolved?

Recombinant expression of Sphingopyxis alaskensis ATP synthase subunit b (atpF) frequently encounters several challenges that require systematic troubleshooting approaches. Protein toxicity represents a common issue, as expression of membrane proteins can disrupt host cell membrane integrity. This typically manifests as growth arrest shortly after induction, poor final cell density, or plasmid instability. To address this, researchers should implement tight regulation of expression using inducible promoters with minimal leakage (such as the pBAD system), employ specialized expression strains designed for toxic proteins (C41/C43(DE3) or BL21-AI), and reduce expression temperature to 18-20°C to slow production and allow proper membrane integration. Inclusion body formation presents another frequent challenge, particularly when expressing membrane proteins in heterologous hosts. This can be identified through SDS-PAGE analysis of soluble versus insoluble fractions after cell lysis. Potential solutions include fusion with solubility-enhancing tags (MBP, SUMO, or TrxA), optimization of induction parameters (lower inducer concentration, induction at higher cell density), and addition of chemical chaperones like glycerol (5-10%) or specific amino acids important for S. alaskensis metabolism, such as alanine .

Codon usage bias between S. alaskensis and expression hosts can lead to translational stalling and incomplete protein synthesis. This is particularly relevant when expressing proteins from organisms with distinctive codon preferences, such as marine bacteria. Signs include low expression yields despite high mRNA levels or truncated proteins detected by Western blot. Recommended solutions involve either synthetic gene optimization for the expression host or co-expression of rare tRNAs using plasmids like pRARE. Protein degradation during expression or purification represents another common issue, identifiable through Western blot analysis showing multiple bands or declining yields during purification. This can be addressed by adding protease inhibitors during all purification steps, reducing the purification temperature to 4°C, and minimizing the time between cell harvest and protein purification. Additionally, incorporating specific experimental design approaches can help systematically evaluate different expression and purification conditions. For example, a factorial design varying temperature, inducer concentration, and media composition can efficiently identify optimal conditions, potentially saving considerable time and resources compared to one-factor-at-a-time optimization.

How can researchers overcome challenges in structural studies of S. alaskensis ATP synthase components?

Structural studies of Sphingopyxis alaskensis ATP synthase components present unique challenges that require specialized approaches. The intrinsically dynamic nature of ATP synthase subunits, particularly the b subunit with its extended structure, can hinder crystallization efforts. To overcome this, researchers should employ protein engineering strategies such as designing constructs with reduced flexibility (guided by disorder prediction algorithms), creating fusion proteins with well-crystallizing partners like T4 lysozyme or BRIL, or co-crystallization with stabilizing antibody fragments. Cryogenic electron microscopy (cryo-EM) offers an alternative approach that is less affected by protein flexibility, but sample preparation requires optimization. The protein concentration typically needs to be 2-5 mg/mL, and detergent selection is critical—maltoside detergents (DDM, UDM) generally perform well, but systematic screening of alternatives may be necessary. Vitrification conditions require careful optimization, with protein-specific adaptation of blotting times (typically 3-6 seconds) and grid types (Quantifoil R1.2/1.3 or R2/2 often serve as good starting points).

For NMR studies, the size of ATP synthase components presents a significant challenge. The b subunit, despite its extended nature, can be challenging to study by traditional NMR approaches. Researchers should consider segmental labeling techniques to focus on specific domains or implement advanced TROSY-based pulse sequences that improve spectral quality for larger proteins. Perdeuteration combined with selective protonation of specific amino acid types can greatly enhance spectral resolution. Sample conditions require careful optimization regarding pH (typically 6.5-7.5), ionic strength (100-250 mM salt), and detergent concentration (typically just above the critical micelle concentration). For integrative structural biology approaches, data from multiple techniques must be properly weighted and combined. Cross-linking mass spectrometry can provide valuable distance constraints, but requires careful optimization of crosslinker type (e.g., BS3, DSS, or photo-crosslinkers) and reaction conditions (crosslinker concentration, reaction time, and temperature). Small-angle X-ray scattering (SAXS) data collection benefits from inline size exclusion chromatography to ensure sample monodispersity. The structural data should be integrated using specialized software platforms like IMP (Integrative Modeling Platform) or HADDOCK, with appropriate weighting of different data sources based on their precision and reliability. Throughout these structural studies, maintaining the protein in conditions that mimic its native environment—considering the oligotrophic marine origin of S. alaskensis—is crucial for obtaining biologically relevant structural information.

What approaches can resolve conflicting data in ATP synthase functional studies?

When conflicting data persists despite technical validation, biological factors may be responsible. Researchers should consider investigating isoform-specific effects (if multiple atpF transcript variants exist in S. alaskensis), post-translational modifications (using mass spectrometry to identify and quantify modifications like phosphorylation), or the influence of environmental factors reflecting S. alaskensis' natural oligotrophic marine habitat . Different functional readouts may legitimately yield different results if they measure distinct aspects of ATP synthase function. For example, ATP hydrolysis assays measure catalytic activity independent of coupling efficiency, while proton pumping assays specifically assess the integrity of the proton translocation pathway. Reconstitution conditions can dramatically affect functional measurements of membrane proteins; systematic variation of lipid composition, protein-to-lipid ratios, and reconstitution methods (detergent dilution versus dialysis) can help identify the source of variability.

Integration of computational modeling with experimental data offers another approach to resolve conflicts. Molecular dynamics simulations can test hypotheses about how specific conditions might affect protein behavior, generating predictions that can be experimentally tested. Finally, researchers should consider the biological context; S. alaskensis' adaptation to oligotrophic conditions may result in ATP synthase regulation that differs from model organisms, potentially explaining apparently conflicting results when assays are performed under different conditions. A decision matrix approach (Table 3) can help systematically evaluate conflicting data:

Conflicting ObservationPotential CausesDiagnostic ApproachesResolution Strategy
Different ATP hydrolysis rates between studiesBuffer composition differencesSystematic buffer component variationStandardize buffer to mimic marine conditions
Inconsistent proton pumping efficiencyLipid composition in reconstitutionLipidomics of native membranesUse defined lipid mixtures matching native composition
Variable subunit stoichiometryAssembly differences in reconstitutionNative MS analysisOptimize assembly protocol based on native conditions
Discrepancies in inhibitor sensitivityPost-translational modificationsPhosphoproteomic analysisControl PTM status through phosphatase/kinase treatment

How can studies of S. alaskensis ATP synthase inform our understanding of bacterial adaptation to nutrient-limited environments?

Studies of Sphingopyxis alaskensis ATP synthase provide unique insights into bacterial adaptation to nutrient-limited environments, serving as a model for understanding energy metabolism in oligotrophic conditions that dominate much of the marine ecosystem. S. alaskensis has evolved specific metabolic strategies to thrive in environments with extremely low nutrient availability, including a simplified metabolism with constrained pathways at the intersections of carbon and nitrogen metabolism . The ATP synthase complex, as the primary ATP-generating machinery, likely plays a central role in these adaptations. Comparative analysis of ATP synthase efficiency between S. alaskensis and bacteria from nutrient-rich environments can reveal how evolution has optimized energy transduction under resource limitation. Specific adaptations might include higher ATP yield per proton transported, improved regulatory mechanisms that rapidly respond to fluctuating nutrient levels, and structural modifications that enhance stability under stress conditions. The fact that S. alaskensis shows a physiological capacity to exploit increases in ambient nutrient availability and achieve high population densities suggests sophisticated regulatory mechanisms governing its energy production machinery.

Research on S. alaskensis ATP synthase also informs broader ecological questions about microbial community succession in marine environments. Studies have shown that microbial communities undergo distinct phases of ecological succession on marine particles, with specific functional groups associated with each stage regardless of the substrate . Understanding how ATP synthase and other energy-generating systems are adapted in organisms from different succession phases can reveal how energy metabolism shapes community assembly and dynamics. The unique positioning of S. alaskensis as an ultramicrobacterium with a relatively large genome (3.35 Mbp) compared to other oligotrophic bacteria like 'Candidatus Pelagibacter ubique' (1.31 Mbp) raises interesting questions about the evolutionary trade-offs between genome size, metabolic versatility, and energy efficiency in nutrient-limited environments. Proteomic studies tracking ATP synthase expression and modification across different growth conditions can reveal how S. alaskensis balances the high energy cost of protein synthesis with the need for efficient energy generation. These insights extend beyond marine ecosystems to other oligotrophic environments, including nutrient-limited freshwater systems, subsurface environments, and even host-associated microbiomes during nutrient restriction, potentially informing strategies for engineering bacteria with enhanced survival in resource-limited conditions.

What evolutionary insights can be gained from comparing ATP synthase components across marine bacterial species?

Comparative analysis of ATP synthase components across marine bacterial species provides a powerful framework for understanding evolutionary adaptations to diverse marine niches. The ATP synthase complex, being essential for energy production, represents a highly conserved machinery that nevertheless shows specific adaptations reflecting the ecological constraints of different marine environments. By examining the atpF gene and b subunit protein sequences across a phylogenetically diverse set of marine bacteria—from oligotrophs like Sphingopyxis alaskensis and 'Candidatus Pelagibacter ubique' to copiotrophs like Vibrio species—researchers can identify signature sequence changes that correlate with specific ecological strategies. These comparisons reveal how selective pressures in different marine niches have shaped the evolution of this critical energy-generating complex. For instance, bacteria adapted to feast-and-famine cycles in coastal waters (those found in selection and facilitation phases of particle colonization ) show distinctive features in their ATP synthase components compared to those specialized for consistent but low nutrient levels in the open ocean.

Molecular clock analyses of ATP synthase genes can provide insights into the timing of major adaptive radiations in marine bacterial lineages, potentially correlating with historical changes in ocean chemistry and nutrient availability. Positive selection analysis using dN/dS ratios can identify specific residues under selection pressure in different marine environments, revealing the molecular basis of adaptation. Ancestral sequence reconstruction offers another powerful approach, allowing researchers to resurrect and characterize ancestral forms of ATP synthase components to directly test hypotheses about the fitness effects of historical sequence changes. Structural biology approaches comparing ATP synthase components across species can reveal how sequence differences translate into functional adaptations. For example, differences in the flexibility, stability, or interaction surfaces of the b subunit may reflect adaptations to specific environmental parameters like temperature, pressure, or salinity gradients experienced by different marine bacteria. Horizontal gene transfer (HGT) detection algorithms applied to ATP synthase genes can reveal instances where adaptive variants have been shared between lineages, providing insights into the role of HGT in accelerating adaptation to changing marine environments. These evolutionary analyses collectively build a comprehensive understanding of how this central component of cellular energetics has been shaped by the diverse and often challenging conditions of marine environments.

What are the most promising future research directions for studying S. alaskensis ATP synthase and its components?

The study of Sphingopyxis alaskensis ATP synthase holds significant promise for advancing multiple fields, from fundamental bioenergetics to biotechnological applications. Several high-priority research directions emerge at the intersection of technological advances and unresolved questions. Single-molecule biophysics approaches represent a frontier area, offering unprecedented insights into the mechanics and dynamics of ATP synthase function. Techniques such as single-molecule FRET, magnetic tweezers, or high-speed AFM could reveal how the b subunit's conformational dynamics contribute to the rotary mechanism, particularly under the energy-limited conditions characteristic of S. alaskensis' natural environment. These approaches could address fundamental questions about how oligotrophic bacteria have optimized the efficiency and regulatory responsiveness of their energy-generating machinery. In vivo imaging using fluorescently tagged ATP synthase components combined with super-resolution microscopy could reveal the spatial organization and dynamics of ATP synthase in living S. alaskensis cells, potentially uncovering unique adaptations in membrane organization that enhance energy capture efficiency.

Comparative systems biology approaches integrating transcriptomics, proteomics, and metabolomics data from S. alaskensis grown under defined nutrient limitations could reveal how ATP synthase regulation is integrated with broader metabolic networks in oligotrophic specialists. This multi-omics approach would help construct predictive models of how marine bacteria optimize energy generation in response to environmental fluctuations, building on the understanding of S. alaskensis' ability to exploit increases in nutrient availability . Synthetic biology approaches represent another promising direction, where engineered variants of S. alaskensis ATP synthase components could be designed to test hypotheses about the functional significance of specific sequence features or to create optimized energy-generating systems for biotechnological applications. The adaptation of S. alaskensis to low-nutrient conditions suggests its ATP synthase might have unique properties valuable for applications requiring high efficiency at low substrate concentrations.

Expanding ecological context by studying ATP synthase expression and modification across the phases of marine particle colonization could reveal how energy metabolism is optimized during community succession. Climate change implications represent an urgent research direction, as ocean warming and acidification may significantly impact the efficiency and regulation of ATP synthase in marine bacteria like S. alaskensis. Understanding these effects is crucial for predicting how changing ocean conditions will affect microbial community function and biogeochemical cycles. Table 4 outlines key research questions, methodological approaches, and potential impacts for future studies:

Research QuestionMethodological ApproachPotential Impact
How does S. alaskensis ATP synthase maintain efficiency under extreme nutrient limitation?Single-molecule biophysics, cryo-EM structures in different nucleotide statesFundamental insights into bioenergetic optimization strategies
What regulatory mechanisms allow rapid adaptation to nutrient fluctuations?Time-resolved proteomics, phosphoproteomics, interactomicsUnderstanding of bacterial response to environmental change
How do ATP synthase properties correlate with succession phases in marine communities?Metatranscriptomics and metaproteomics of natural communitiesEcological insights into community assembly processes
Can S. alaskensis ATP synthase components be engineered for improved performance?Directed evolution, rational design based on structural insightsBiotechnological applications in bioenergy and bioprocessing
How will ocean acidification affect ATP synthase function in marine bacteria?In vitro and in vivo functional studies under predicted future ocean conditionsClimate change impact predictions on marine microbial processes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.