Recombinant Sphingopyxis alaskensis Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
mscL; Sala_0992; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) (Sphingomonas alaskensis)
Target Names
mscL
Target Protein Sequence
MLGEFRQFIARGNVMDLAVGVIIGGAFATITGSLTEDVIMPLVGALFGGVDFSNRFILLG SVPDGMSATDYAALKEAGVAMIGYGAFVTAVINFLILAFIIFLLVRWVNKVVRKPEADAS PAGPSEVDLLTEIRDELRRK
Uniprot No.

Target Background

Function

A mechanosensitive channel that opens in response to membrane stretch. It may play a role in regulating cellular osmotic pressure.

Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Sphingopyxis alaskensis large-conductance mechanosensitive channel?

The Sphingopyxis alaskensis large-conductance mechanosensitive channel (mscL) is a membrane protein that functions as a safety valve in bacterial cells, opening in response to stretch forces in the lipid bilayer. This channel forms a homopentamer with each subunit containing two transmembrane regions and gates via a bilayer mechanism triggered by hydrophobic mismatch, membrane curvature changes, and alterations in transbilayer pressure profiles . In S. alaskensis, an ultramicrobacterium adapted to nutrient-depleted marine environments, this channel is part of the essential cellular machinery that prevents cell lysis during osmotic stress .

What is the structural composition of S. alaskensis mscL?

The S. alaskensis mscL protein forms a homopentameric structure with each subunit containing two transmembrane regions. According to available sequence data, the full amino acid sequence is: mLGEFRQFIARGNVMDLAVGVIIGGAFATITGSLTEDVIMPLVGALFGGVDFSNRFILLGSVPDGMSATDYAALKEAGVAMIGYGAFVTAVINFLILAFIIFLLVRWVNKVVRKPEADASPAGPSEVDLLTEIRDELRRK . The protein consists of 140 amino acids and is encoded by the mscL gene (Sala_0992) in the S. alaskensis genome . The channel structure features gates that respond to membrane tension through conformational changes in the transmembrane domains.

Why is S. alaskensis significant for mechanosensitive channel research?

Sphingopyxis alaskensis is an important model organism for studying mechanosensitive channels due to its ecological significance and unique adaptations. This marine bacterium is numerically abundant in oligotrophic waters ranging from 4-10°C, including Alaskan waters, the North Sea, and the North Pacific . As an ultramicrobacterium with a cell volume less than 0.1 μm³, S. alaskensis has evolved specialized mechanisms to thrive in nutrient-limited environments . Its capacity for oligotrophic growth is linked to unique genetic and physiological properties that differ fundamentally from well-studied bacteria such as Escherichia coli . These adaptations include sophisticated membrane systems with specialized channels like mscL that help maintain cellular integrity under environmental stress.

How does the mscL channel function during osmotic regulation?

The mscL channel functions as a critical component of bacterial osmotic regulation by acting as a pressure-sensitive safety valve. During sudden osmotic down-shock, water rapidly enters the cell, increasing turgor pressure and membrane tension . This mechanical stress triggers the opening of the mscL channel, allowing the rapid efflux of cytoplasmic solutes to prevent cell lysis . The channel's gating is directly controlled by membrane tension rather than ligand binding, with the protein undergoing conformational changes in response to stretching forces in the lipid bilayer . In S. alaskensis, which inhabits fluctuating marine environments, these channels are particularly important for maintaining cellular integrity during environmental transitions.

How does the S. alaskensis mscL differ structurally and functionally from other bacterial mechanosensitive channels?

The S. alaskensis mscL, while sharing the fundamental pentameric structure common to large-conductance mechanosensitive channels, exhibits specific adaptations reflective of its marine oligotrophic lifestyle. Unlike the extensively studied E. coli mscL, the S. alaskensis channel likely possesses modified tension sensitivity thresholds adapted to the relatively stable osmotic conditions of open ocean environments . Bacteria typically possess different types of mechanosensitive channels (MscL, MscS, MscM, MscK) with varying gating properties and channel diameters, providing a graded response to osmotic challenges .

The functional differences between S. alaskensis mscL and other bacterial channels may include:

FeatureS. alaskensis mscLE. coli mscLOther Bacterial Channels
Gating Tension ThresholdPotentially adapted to stable marine environmentsWell-characterized response to hypoosmotic shockVaries by species and ecological niche
Channel Diameter (open state)Not fully characterizedLarge (>30 Å)Varies by channel type (MscS < MscL)
Expression PatternsConstitutive with potential upregulation during nutrient limitationUpregulated during stationary phase and osmotic shockSpecies-dependent regulation
Environmental AdaptationOligotrophic marine conditions (4-10°C)Mesophilic intestinal and environmental conditionsVaries by habitat requirements

These differences reflect evolutionary adaptations to S. alaskensis' unique ecological niche as an ultramicrobacterium in nutrient-poor marine environments .

What experimental approaches are most effective for studying the gating mechanics of recombinant S. alaskensis mscL?

Several sophisticated experimental approaches can effectively characterize the gating mechanics of recombinant S. alaskensis mscL:

  • Patch-clamp electrophysiology: This gold-standard technique allows direct measurement of channel activity by applying controlled tension to membrane patches containing the reconstituted channel. Researchers can measure conductance, ion selectivity, and gating thresholds under varying membrane tensions .

  • Reconstitution in liposomes and giant unilamellar vesicles (GUVs): Purified recombinant mscL can be incorporated into artificial membranes with controlled lipid composition. Fluorescent dye release assays upon osmotic downshift can then quantify channel activity, while high-speed video microscopy can capture membrane deformation during channel gating .

  • Molecular dynamics simulations: Computational approaches can model the conformational changes in S. alaskensis mscL during gating, providing insights into the molecular mechanisms that might be difficult to capture experimentally .

  • Site-directed spin labeling with electron paramagnetic resonance (EPR): This approach can track conformational changes in specific regions of the channel protein during gating, offering detailed structural information about the transition between closed and open states.

  • Fluorescence resonance energy transfer (FRET): By labeling different domains of the channel with appropriate fluorophores, researchers can monitor conformational changes in real-time during channel gating.

These methodologies, especially when used in combination, can provide a comprehensive picture of how the S. alaskensis mscL responds to membrane tension.

How might the oligotrophic adaptation of S. alaskensis influence its mscL channel properties?

The oligotrophic adaptation of S. alaskensis likely has profound effects on its mscL channel properties, reflecting evolutionary optimization for survival in nutrient-limited marine environments . Several potential adaptations may include:

  • Enhanced sensitivity to membrane tension: As an ultramicrobacterium with limited cytoplasmic resources, S. alaskensis may have evolved mscL channels with finely tuned gating thresholds to prevent unnecessary solute loss while maintaining protection against osmotic lysis.

  • Energetic efficiency: Given that S. alaskensis thrives in energy-limited environments, its mscL channel may exhibit reduced energy barriers for conformational changes during gating, minimizing the energetic cost of channel operation.

  • Altered lipid interactions: The marine environment and cold-temperature adaptation (4-10°C) likely necessitate specific lipid-protein interactions that maintain appropriate membrane fluidity and channel function under these conditions .

  • Integration with specialized metabolic pathways: S. alaskensis has evolved constrained metabolic pathways, especially at the intersections of carbon and nitrogen metabolism, to optimize resource utilization . The mscL channel may be integrated with these pathways, potentially through selective permeability to specific metabolites or regulatory interactions.

  • Response to nutrient availability fluctuations: Unlike some strictly oligotrophic bacteria (e.g., SAR11 clade), S. alaskensis shows physiological capacity to exploit increases in ambient nutrient availability . This suggests its mscL channels may exhibit adaptive regulation in response to changing nutrient conditions.

These adaptations would represent specialized evolutionary solutions to the challenges of maintaining osmotic homeostasis in nutrient-limited marine environments.

What is the potential significance of S. alaskensis mscL in antimicrobial development?

The S. alaskensis mscL represents a promising target for novel antimicrobial development strategies due to several key factors:

  • Conserved essential function: Mechanosensitive channels serve as critical safety valves in bacteria, and their dysfunction can lead to cell lysis during osmotic stress . This essential role makes them attractive antimicrobial targets.

  • Unique activation mechanism: Unlike many conventional antibiotic targets, mscL channels are activated by physical forces (membrane tension) rather than ligand binding . This mechanical gating mechanism offers innovative approaches for antimicrobial development through compounds that artificially trigger channel opening or lock channels in an open state, leading to uncontrolled solute loss and eventual cell death.

  • Structural distinctiveness: The pentameric structure and specialized gating mechanism of bacterial mscL channels differ significantly from eukaryotic mechanosensitive channels, potentially allowing for selective targeting with reduced host toxicity .

  • Potential against drug-resistant strains: The pharmacological potential of mscL may involve discovery of new-age antibiotics effective against multiple drug-resistant bacterial strains . As mechanosensitive channels serve fundamental physiological functions through a physical mechanism, resistance might be slower to develop compared to conventional antibiotic targets.

  • Ecological insights: Understanding the specialized adaptations of S. alaskensis mscL to oligotrophic environments could inform antimicrobial strategies targeting similar channels in pathogens that must survive nutrient limitation during infection or environmental persistence.

This research direction could potentially address urgent needs in combating multidrug-resistant bacterial infections as highlighted by the CDC and other health authorities .

What are the optimal expression systems for producing recombinant S. alaskensis mscL?

The optimal expression of recombinant S. alaskensis mscL requires careful consideration of several factors to ensure proper folding, membrane insertion, and functional integrity of this pentameric membrane protein:

  • Bacterial expression systems:

    • E. coli C41(DE3) or C43(DE3): These "Walker strains" are specifically engineered for membrane protein expression and can accommodate the potentially toxic effects of overexpressing channel proteins.

    • E. coli BL21(DE3) pLysS: This strain offers tight control of expression through T7 lysozyme production, reducing basal expression that might be detrimental for membrane channel proteins.

  • Expression vectors and fusion partners:

    • Vectors with tunable promoters (like pBAD systems) allow precise control of expression levels.

    • N-terminal fusions with MBP (maltose-binding protein) or Mistic (membrane-integrating sequence for translation of integral membrane protein constructs) can enhance membrane insertion.

    • C-terminal His-tags facilitate purification while minimizing interference with channel assembly.

  • Induction conditions:

    • Lower temperatures (16-20°C) after induction slow protein production, allowing proper membrane insertion and folding.

    • Reduced inducer concentrations extend expression time while preventing cytotoxic accumulation.

  • Membrane-mimetic environment considerations:

    • Supplementation with phospholipids similar to those found in marine bacterial membranes may improve functional expression.

    • Co-expression with chaperones specific for membrane proteins can enhance proper folding.

  • Cell-free expression systems:

    • For difficult-to-express variants, cell-free systems supplemented with lipid nanodiscs or liposomes offer direct insertion into membrane-mimetic environments.

The optimal purification strategy would involve gentle solubilization with mild detergents (such as n-Dodecyl β-D-maltoside or digitonin) followed by affinity chromatography under conditions that maintain the pentameric assembly.

How can researchers effectively reconstitute functional S. alaskensis mscL for biophysical studies?

Effective reconstitution of functional S. alaskensis mscL for biophysical studies requires careful attention to membrane composition, protein-to-lipid ratios, and reconstitution protocols:

  • Selection of appropriate membrane mimetics:

    • Liposomes: Composed of defined lipid mixtures that can mimic the native membrane environment of S. alaskensis. Consider including phosphatidylglycerol, phosphatidylethanolamine, and cardiolipin at physiologically relevant ratios.

    • Nanodiscs: Provide a defined, monodisperse membrane environment. MSP1D1 scaffold proteins can create nanodiscs of appropriate size for the pentameric mscL channel.

    • Giant Unilamellar Vesicles (GUVs): Useful for microscopy and patch-clamp studies, allowing direct visualization of channel activity.

  • Reconstitution protocols:

    • Detergent-mediated reconstitution: Gradually remove detergent using dialysis, Bio-Beads, or cyclodextrin to allow controlled protein incorporation into liposomes.

    • Direct incorporation: For nanodiscs, combine purified mscL, MSP proteins, and lipids in the presence of detergent, followed by controlled detergent removal.

  • Validation of functional reconstitution:

    • Patch-clamp electrophysiology: Verify channel conductance and tension sensitivity.

    • Fluorescent dye release assays: Monitor efflux of encapsulated fluorescent dyes in response to osmotic downshift or membrane perturbing agents.

    • Electron microscopy: Confirm proper channel incorporation and distribution in the membrane.

  • Consideration of environmental factors:

    • Temperature control (4-10°C) to match S. alaskensis' native environment.

    • Buffer composition mimicking marine conditions (higher salt concentration).

    • pH adjustment to optimal range for channel activity.

  • Quality control metrics:

    • Protein-to-lipid ratios should be carefully optimized (typically starting at 1:1000 molar ratio).

    • Size distribution of proteoliposomes should be monitored by dynamic light scattering.

    • Orientation of incorporated channels should be assessed using proteolytic digestion or antibody accessibility assays.

Following these guidelines will ensure reconstitution of functionally active channels suitable for detailed biophysical characterization.

How should researchers design experiments to compare S. alaskensis mscL with other bacterial mechanosensitive channels?

Designing rigorous comparative experiments between S. alaskensis mscL and other bacterial mechanosensitive channels requires a multi-faceted approach:

  • Standardized expression and purification:

    • Express all channels using identical vectors, tags, and host systems.

    • Purify using identical protocols to eliminate method-based variations.

    • Verify protein purity, homogeneity, and pentameric assembly for all channels using SEC-MALS (size exclusion chromatography with multi-angle light scattering).

  • Parallel functional characterization:

    • Patch-clamp electrophysiology: Compare conductance, ion selectivity, and tension sensitivity thresholds under identical membrane patch conditions.

    • Pressure threshold measurements: Determine the membrane tension required for channel opening using identical membrane compositions.

    • Gating kinetics analysis: Measure opening and closing rates in response to defined tension changes.

  • Comparative structural analysis:

    • Cryo-EM or X-ray crystallography of each channel under identical conditions.

    • Hydrogen-deuterium exchange mass spectrometry to compare conformational flexibility.

    • Site-directed spin labeling and EPR to analyze specific structural elements.

  • Environmental response profiling:

    • Test channel function across temperature ranges (4-40°C).

    • Evaluate performance in different lipid compositions mimicking native bacterial membranes.

    • Assess pH sensitivity profiles.

  • Genetic complementation studies:

    • Create mscL-deficient bacterial strains.

    • Introduce each mscL variant and measure osmotic shock survival under standardized conditions.

    • Evaluate growth and fitness under various environmental stresses.

  • Statistical design considerations:

    • Ensure sufficient technical replicates (n≥3) for each measurement.

    • Include biological replicates with independently prepared protein samples.

    • Use appropriate statistical tests (ANOVA with post-hoc tests) to identify significant differences.

This systematic approach will allow robust identification of unique features of S. alaskensis mscL relative to other bacterial mechanosensitive channels.

What approaches can elucidate the relationship between S. alaskensis' oligotrophic lifestyle and mscL function?

To elucidate the relationship between S. alaskensis' oligotrophic lifestyle and mscL function, researchers should employ a combination of comparative genomics, functional assays, and environmental simulations:

  • Comparative genomics and evolutionary analysis:

    • Compare mscL sequences across bacterial species from different nutritional niches (oligotrophic vs. copiotrophic).

    • Identify positively selected residues in the S. alaskensis mscL that might represent oligotrophic adaptations.

    • Analyze the genomic context of mscL in S. alaskensis to identify potential co-regulated genes involved in stress response.

  • Nutrient-dependent expression studies:

    • Measure mscL expression levels under varying nutrient concentrations using RT-qPCR or reporter constructs.

    • Perform proteomic analysis to determine if mscL abundance changes with nutrient availability.

    • Use ChIP-seq to identify regulatory proteins that control mscL expression under nutrient limitation.

  • Functional characterization under oligotrophic conditions:

    • Compare channel gating properties in membrane environments with varying lipid compositions reflecting nutrient-replete versus nutrient-limited conditions.

    • Evaluate channel function at the low temperatures (4-10°C) characteristic of S. alaskensis' natural environment .

    • Assess how carbon and nitrogen substrate availability affects channel expression and function, particularly examining the role of alanine, which is important in S. alaskensis metabolism .

  • Mutational analysis:

    • Create chimeric channels combining domains from S. alaskensis mscL with those from non-oligotrophic bacteria.

    • Perform site-directed mutagenesis on residues unique to S. alaskensis mscL to assess their contribution to oligotrophic adaptation.

    • Evaluate how these mutations affect survival under combined nutrient limitation and osmotic stress.

  • Microcosm experiments:

    • Design laboratory microcosms mimicking oligotrophic marine environments.

    • Compare growth and survival of wild-type S. alaskensis versus mscL mutants.

    • Evaluate competitive fitness against other marine bacteria under oligotrophic conditions.

These integrated approaches will help establish whether and how the mscL channel has specifically adapted to support S. alaskensis' success in nutrient-limited marine environments.

How should researchers interpret contradictory findings in S. alaskensis mscL functional studies?

When confronted with contradictory findings in S. alaskensis mscL functional studies, researchers should employ a systematic approach to resolve discrepancies:

  • Methodological reconciliation:

    • Experimental conditions assessment: Compare precise buffer compositions, temperature, pH, and membrane tension application methods between studies.

    • Protein preparation differences: Evaluate expression systems, purification methods, and storage conditions that might affect channel integrity.

    • Reconstitution variations: Analyze lipid compositions, protein-to-lipid ratios, and reconstitution procedures that could impact channel behavior.

  • Analytical framework for resolution:

    • Parameter-specific analysis: Create a comprehensive table comparing all experimental parameters between contradictory studies:

    ParameterStudy AStudy BStudy CPotential Impact on Results
    Expression systemE. coli C41(DE3)S. cerevisiaeCell-freeFolding differences, post-translational modifications
    Membrane composition70:30 PC:PGNative E. coli lipidsSynthetic nanodiscsHydrophobic mismatch, lateral pressure profile
    Temperature25°C4°C37°CMembrane fluidity, protein dynamics
    Applied tensionPatch-clamp suctionOsmotic downshiftAmphipath additionDifferent modes of force transduction
  • Hierarchical evidence evaluation:

    • Weight findings based on methodological proximity to native conditions (considering S. alaskensis' oligotrophic marine environment at 4-10°C) .

    • Prioritize results from complementary techniques that address the same question through different approaches.

    • Consider whether contradictions represent true biological heterogeneity in channel behavior rather than methodological artifacts.

  • Model reconciliation strategies:

    • Develop integrative models that can explain seemingly contradictory results under different experimental conditions.

    • Consider whether the channel exhibits context-dependent behavior that manifests differently under various experimental setups.

    • Use computational modeling to predict how different experimental conditions might alter channel function.

  • Targeted validation experiments:

    • Design experiments specifically to test hypotheses about the source of contradictions.

    • Systematically vary single parameters between contradictory protocols to identify critical variables.

    • Include positive controls (well-characterized channels like E. coli MscL) to benchmark experimental systems.

This structured approach transforms contradictory findings from obstacles into opportunities for deeper understanding of the complex functional properties of S. alaskensis mscL.

What statistical approaches are most appropriate for analyzing S. alaskensis mscL electrophysiological data?

Analyzing S. alaskensis mscL electrophysiological data requires specialized statistical approaches to address the hierarchical nature of patch-clamp recordings and the stochastic behavior of ion channels:

What are the key considerations for publishing research on S. alaskensis mscL?

Publishing research on S. alaskensis mscL requires careful attention to several critical considerations that will enhance the impact and reproducibility of the work:

These considerations will ensure that published research on S. alaskensis mscL makes a meaningful contribution to our understanding of bacterial mechanosensation and adaptation to oligotrophic environments.

What future research directions would most advance our understanding of S. alaskensis mscL?

Several promising research directions would significantly advance our understanding of S. alaskensis mscL and its biological significance:

  • High-resolution structural studies:

    • Determine the cryo-EM or X-ray crystal structure of S. alaskensis mscL in multiple conformational states.

    • Compare structural features with other bacterial mechanosensitive channels to identify unique adaptations.

    • Use molecular dynamics simulations to understand the energetics of gating transitions in the context of oligotrophic adaptations.

  • In vivo functional characterization:

    • Develop genetic tools for manipulating S. alaskensis to study mscL function in its native context.

    • Create reporter systems to monitor mscL expression under different environmental conditions.

    • Perform competition experiments between wild-type and mscL mutants under varying nutrient and osmotic conditions.

  • Ecological significance investigations:

    • Study mscL expression and function in natural marine samples to understand its role in oligotrophic environments.

    • Investigate whether mscL contributes to S. alaskensis' role in carbon sequestration processes in marine ecosystems .

    • Examine how climate change and increasing ocean oligotrophy might affect bacteria with specialized mechanosensitive systems.

  • Biotechnological applications exploration:

    • Develop S. alaskensis mscL as a potential target for new antimicrobial compounds effective against drug-resistant bacteria .

    • Engineer the channel for biosensor applications detecting mechanical forces in artificial systems.

    • Explore the potential for using modified channels in controlled substance release applications.

  • Comparative evolution analysis:

    • Conduct comprehensive phylogenetic analysis of mscL across diverse bacterial species from different environmental niches.

    • Identify signatures of selection that might explain adaptations to oligotrophic conditions.

    • Use ancestral sequence reconstruction to trace the evolutionary history of mechanosensitive channels in marine bacteria.

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics to understand how mscL integrates with broader cellular responses to environmental stress.

    • Map interaction networks between mscL and other cellular components involved in osmotic regulation and nutrient utilization.

    • Develop systems biology models that predict mscL behavior under complex environmental scenarios.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.