Recombinant Sphingopyxis alaskensis NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Sala_1299; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) (Sphingomonas alaskensis)
Target Names
nuoK
Target Protein Sequence
MISVGHYLAVSAVLFTLGVLGIFINRKNIIVILMAIELILLAVNINLVAFSAALGDLVGQ VFSMFVLTVAAGEAAIGLAILVIYFRGRGTIAVDDANRMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. The enzyme couples the redox reaction to proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thus conserving the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the taxonomic classification of Sphingopyxis alaskensis and how does it relate to other sphingomonads?

Sphingopyxis alaskensis belongs to the family Sphingomonadaceae, which has undergone significant taxonomic reclassification in recent decades. Based on phylogenomic analysis, Sphingopyxis forms a distinct clade that is closely related to Novosphingobium, with the Sphingobium clade serving as a sister group to this combined clade . Traditional classification of sphingomonads relied on biochemical tests, but modern genome-based taxonomy provides more definitive classification with strong bootstrap support at major taxonomic splits .

The genus Sphingopyxis was created when the original Sphingomonas genus was redivided into five independent genera: Sphingomonas, Sphingopyxis, Sphingobium, Novosphingobium, and Sphingosinicella . This reclassification was based on phylogenetic, chemotaxonomic, and physiological analyses . When studying S. alaskensis nuoK, it's important to consider its evolutionary relationship with homologous proteins in related genera, as this can provide insights into functional conservation and specialization.

What is the general function of NADH-quinone oxidoreductase in bacterial metabolism?

NADH-quinone oxidoreductase, also known as Complex I of the respiratory chain, plays a crucial role in cellular energy metabolism. In bacteria like Sphingopyxis, this enzyme complex:

  • Catalyzes the transfer of electrons from NADH to quinones

  • Contributes to establishing the proton gradient necessary for ATP synthesis

  • Serves as a key component of the electron transport chain

  • Links the tricarboxylic acid (TCA) cycle to oxidative phosphorylation

The nuoK subunit specifically is a membrane-embedded component that contributes to proton translocation across the membrane. In the context of Sphingopyxis alaskensis, which is found in diverse ecological niches including contaminated soil and marine environments , the NADH-quinone oxidoreductase complex likely plays an important role in the organism's energy metabolism and potentially in its ability to metabolize various carbon sources, including aromatic compounds.

What expression systems are most suitable for producing recombinant Sphingopyxis alaskensis nuoK?

When expressing recombinant Sphingopyxis alaskensis nuoK, researchers should consider several expression systems based on the protein's characteristics:

For optimal experimental design, researchers should include proper controls and optimize expression conditions through factorial design approaches . This would involve systematically varying parameters such as temperature, inducer concentration, and expression time to identify optimal conditions that maximize functional protein yield.

How should researchers design experiments to characterize the function of recombinant Sphingopyxis alaskensis nuoK?

Characterizing the function of recombinant S. alaskensis nuoK requires a well-structured experimental approach:

Table 1: Recommended Experimental Design for nuoK Characterization

Experimental PhaseKey MethodsControlsStatistical Considerations
Expression ValidationWestern blotting, SDS-PAGENon-induced samples, Empty vectorTriplicate expression trials
LocalizationMembrane fractionation, GFP fusionCytosolic protein controlQuantitative imaging analysis
Activity AssaysNADH oxidation assays, Proton translocationHeat-inactivated enzyme, Known inhibitorsPower analysis for sample size (n≥3)
Interaction StudiesCo-immunoprecipitation, CrosslinkingSingle subunit controlsStatistical validation of interactions

When designing experiments, researchers should adhere to key principles including:

  • Replication: Multiple independent replicates are essential to ensure reproducibility and statistical validity .

  • Randomization: Samples should be processed in random order to avoid systematic bias from processing sequence .

  • Blocking: When testing multiple conditions, samples should be grouped (blocked) to minimize variability from external factors .

  • Sequential experimentation: A step-wise approach allows refinement based on initial results, especially when optimizing purification or activity conditions .

For statistical validity, researchers should perform power analyses to determine appropriate sample sizes. As a guideline, sample size increases with higher desired power, smaller detectable differences, and higher variance in measurements .

What are the key considerations for purifying recombinant Sphingopyxis alaskensis nuoK protein?

Purifying recombinant nuoK presents unique challenges due to its membrane-associated nature. A methodical approach should account for:

  • Membrane extraction optimization: Test different detergents (DDM, LMNG, digitonin) at various concentrations to solubilize nuoK while maintaining native conformation.

  • Affinity tag selection: Compare the efficiency of various tags (His6, FLAG, Strep-II) positioned at either N- or C-terminus, recognizing that tag position may affect protein folding or function.

  • Purification conditions: Systematically evaluate buffer compositions, pH ranges, and salt concentrations that preserve protein stability throughout the purification process.

  • Quality control: Implement size exclusion chromatography to assess oligomeric state and protein homogeneity, coupled with activity assays to confirm functional integrity.

  • Stability assessment: Conduct thermal shift assays to identify stabilizing additives for long-term storage and crystallization trials.

The experimental design should include multifactorial approaches to simultaneously test multiple variables, significantly reducing the number of experiments needed while still providing statistically robust results .

How can researchers effectively analyze the interaction of nuoK with other subunits of the NADH-quinone oxidoreductase complex?

Analyzing subunit interactions requires multiple complementary approaches:

  • Co-expression strategies: Design constructs for co-expression of nuoK with adjacent subunits (e.g., nuoJ and nuoL) to form stable subcomplexes.

  • Crosslinking studies: Implement chemical crosslinking followed by mass spectrometry (XL-MS) to map spatial relationships between subunits.

  • FRET analysis: Develop fluorescently tagged versions of nuoK and potential interaction partners to measure proximity in reconstituted systems.

  • Proteoliposome reconstitution: Systematically test the functional consequences of incorporating various combinations of purified subunits.

Table 2: Sequential Analysis of nuoK Protein Interactions

Analysis StageTechniquesExpected OutcomesValidation Methods
Binary InteractionsBacterial two-hybrid, Pull-down assaysIdentification of direct binding partnersCompetition assays with overlapping peptides
Structural AnalysisCryo-EM, XL-MSSpatial arrangement within complexModel validation with site-directed mutagenesis
Functional ValidationReconstitution assaysMinimum requirements for activityActivity comparison with native complex

For experimental design, researchers should implement a sequential approach, where results from initial interaction screening inform more detailed structural and functional studies . Statistical validation of interaction data should include appropriate controls and sufficient replicates to distinguish significant interactions from background binding.

How does the genomic context of the nuoK gene in Sphingopyxis alaskensis compare to other sphingomonads, and what insights does this provide?

The genomic organization surrounding respiratory chain components can provide valuable insights into their regulation and co-evolution. In sphingomonads, comparative genomic analysis reveals:

  • Conserved operonic structure: NADH-quinone oxidoreductase genes typically occur in operons (nuo operons) containing 13-14 genes (nuoA through nuoN).

  • Regulatory elements: Examination of upstream regions often reveals conserved promoter elements that respond to oxygen tension and energy status.

  • Genomic plasticity: While core functions are conserved, comparative analysis of sphingomonad genomes shows varying degrees of gene synteny and genomic rearrangements .

For nuoK specifically, researchers should examine whether its sequence and genetic context in S. alaskensis exhibit any unique features compared to other sphingomonads. The phylogenomic approach provides more reliable evolutionary context than 16S rRNA-based methods alone, with improved bootstrap support at major taxonomic splits .

What role might nuoK play in the adaptation of Sphingopyxis alaskensis to aromatic compound degradation?

Sphingopyxis species are notable for their ability to degrade aromatic compounds in various environments . The potential connection between respiratory chain components like nuoK and aromatic compound metabolism merits investigation:

  • Energy coupling: Degradation of aromatic compounds typically requires significant energy input, particularly for ring-opening reactions. The NADH-quinone oxidoreductase complex generates the proton motive force necessary for ATP synthesis, potentially providing energy for these metabolic pathways.

  • Electron flow management: During aromatic compound degradation, electron flow must be carefully balanced. The respiratory chain, including nuoK, may play a crucial role in maintaining redox homeostasis.

  • Adaptive changes: Comparative sequence analysis of nuoK across Sphingopyxis strains isolated from different contamination scenarios might reveal adaptive changes that optimize respiratory function under specific metabolic demands.

  • Co-expression patterns: Analysis of transcriptomic data could reveal whether nuoK expression is co-regulated with aromatic degradation pathways, suggesting functional coupling.

Functional profile clustering based on Clusters of Orthologous Groups suggests potential links between metabolic capabilities and substrate-specific traits in Sphingopyxis isolates . Researchers could apply similar clustering approaches to investigate correlations between nuoK sequence variants and aromatic compound degradation capabilities across strains.

How might post-translational modifications affect the function of nuoK in Sphingopyxis alaskensis?

Post-translational modifications (PTMs) of respiratory chain components can significantly impact their function, regulation, and interactions. For nuoK in Sphingopyxis alaskensis:

  • Potential PTM sites: Computational analysis can predict probable sites for phosphorylation, acetylation, and other modifications based on sequence motifs.

  • Environmental responsiveness: PTMs may serve as rapid-response mechanisms to changing environmental conditions, particularly relevant for Sphingopyxis species that inhabit diverse ecological niches .

  • Interaction modulation: Modifications might regulate interactions between nuoK and other subunits of the NADH-quinone oxidoreductase complex.

In the broader context of Sphingomonadaceae, proteins can undergo various modifications that affect their function. For example, epigenetic modifications of histones, including methylation, acetylation, phosphorylation, and citrullination, play key roles in regulating gene expression . While this specifically refers to eukaryotic histones, it illustrates the importance of protein modifications in biological systems.

Research methodologies should include:

  • Mass spectrometry-based PTM mapping

  • Site-directed mutagenesis of putative modification sites

  • Functional assays comparing native and modification-mimicking variants

  • Investigation of PTM enzymes encoded in the S. alaskensis genome

How should researchers address contradictory findings in nuoK functional studies?

When facing contradictory results in nuoK studies, researchers should implement a systematic analytical approach:

  • Experimental variables assessment: Methodically compare experimental conditions across contradictory studies, including expression systems, purification methods, and assay conditions that might contribute to functional differences.

  • Strain-specific variation analysis: Examine whether sequence variations in nuoK might explain functional differences, as Sphingopyxis isolates from different ecological niches may have adapted variations .

  • Technical validation: Implement orthogonal techniques to verify controversial findings, ensuring that observed effects are not artifacts of particular methodological approaches.

  • Statistical rigor: Apply appropriate statistical tests with sufficient power to distinguish genuine effects from random variation. Two-sided tests generally require larger sample sizes than one-sided tests .

Table 3: Framework for Resolving Contradictory Findings

Source of ContradictionInvestigation ApproachStatistical ConsiderationResolution Strategy
Methodological differencesSide-by-side comparison with standardized protocolsMatched statistical tests across methodsIdentify method-dependent effects
Sample preparation variationsSystematic testing of preparation variablesANOVA to identify significant factorsStandardize critical preparation steps
Genetic differencesSequence alignment and variant testingCorrelation analysis of sequence vs. functionIdentify causative sequence variations
Environmental conditionsFactorial design testing multiple conditionsMultifactorial analysisMap condition-dependent functionality

When designing experiments to resolve contradictions, researchers should incorporate blocking to minimize the impact of extraneous variables and ensure appropriate statistical power through preliminary sample size calculations .

What statistical approaches are most appropriate for analyzing nuoK activity data?

The analysis of nuoK activity requires rigorous statistical approaches tailored to the specific experimental design:

  • Power analysis: Before experimentation, conduct power analysis to determine the required sample size based on the minimal biologically significant effect size, desired power (typically 0.8-0.9), and expected variance .

  • Normality testing: Evaluate whether activity data follows normal distribution using Shapiro-Wilk or similar tests. For non-Gaussian distributions, consider non-parametric alternatives or data transformation .

  • Appropriate statistical tests:

    • For comparing two conditions: t-tests (paired or unpaired)

    • For multiple conditions: ANOVA followed by post-hoc tests

    • For relationship between variables: Regression or correlation analysis

  • Multiple testing correction: When performing multiple comparisons, implement Bonferroni, Tukey, or false discovery rate corrections to maintain appropriate experiment-wide error rates.

  • Consideration of experimental design: For repeated measures or nested designs (common in time-course studies of enzyme activity), use mixed-effects models to account for within-subject correlation .

Statistical analysis should recognize that sample size requirements increase with higher variance, smaller effect sizes, and higher desired power . For nuoK activity studies, where variability can be substantial due to the complex nature of membrane proteins, researchers should account for this in their experimental planning.

How might structural biology approaches advance our understanding of nuoK function in Sphingopyxis alaskensis?

Structural biology offers powerful tools to elucidate nuoK function at the molecular level:

  • Cryo-electron microscopy (cryo-EM): With recent advances in resolution, cryo-EM could resolve the structure of the entire NADH-quinone oxidoreductase complex from S. alaskensis, placing nuoK in its functional context.

  • X-ray crystallography: While challenging for membrane proteins, this approach might succeed with stabilized versions of nuoK, potentially revealing key functional sites.

  • NMR studies: Solution or solid-state NMR could provide dynamics information not accessible through static structural methods, particularly relevant for conformational changes during the catalytic cycle.

  • Computational modeling: Homology modeling based on related structures, followed by molecular dynamics simulations, can provide insights into nuoK function when experimental structures are not available.

The experimental design for structural studies should include multiple complementary techniques, with each providing different aspects of structural information . Planning should account for the substantial sample requirements of structural biology, particularly for techniques like X-ray crystallography and NMR, which may necessitate large-scale protein production.

What are the most promising approaches for studying the role of nuoK in Sphingopyxis alaskensis adaptation to extreme environments?

Sphingopyxis species inhabit diverse environments including contaminated soils and marine habitats , suggesting adaptive mechanisms in their energy metabolism. To study nuoK's role in environmental adaptation:

  • Comparative genomics: Analyze nuoK sequences from Sphingopyxis strains isolated from different environments to identify adaptive mutations. Pan-genome analysis has already revealed both core and accessory genomes in Sphingopyxis , providing a framework for such comparisons.

  • Gene expression studies: Measure nuoK expression under various environmental stressors (temperature, pH, contaminants) to identify conditions that modulate its expression.

  • Site-directed mutagenesis: Generate variants mimicking naturally occurring polymorphisms to test their functional consequences in controlled settings.

  • In situ studies: Develop methods to assess respiratory chain function in environmental samples to connect laboratory findings with ecological relevance.

Experimental design should follow a multifactorial approach, simultaneously testing multiple environmental variables to identify significant factors and their interactions . This approach is particularly efficient when studying complex environmental adaptations that may involve multiple interacting factors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.