Sphingopyxis alaskensis is a marine bacterium belonging to the Alphaproteobacteria class, known for its ability to thrive in nutrient-poor (oligotrophic) marine environments . The CrcB protein homolog in S. alaskensis is a protein that likely functions as a fluoride ion transporter .
Recombinant CrcB homolog is produced in E. coli by introducing the crcB gene into E. coli cells, which then express the protein . The crcB gene in Sphingopyxis alaskensis is named Sala_2101 . The recombinant protein includes a His-tag, commonly used for purification purposes .
Fluoride Transport: CrcB is a fluoride ion transporter, crucial for maintaining fluoride homeostasis within the cell .
Oligotrophic Adaptation: Sphingopyxis alaskensis thrives in oligotrophic environments, demonstrating unique genetic and physiological properties different from well-studied bacteria like Escherichia coli .
Sphingopyxis alaskensis is adapted to heterotrophic growth in nutrient-depleted conditions and can utilize specific amino acids and putrescine as sole carbon and nitrogen sources . It demonstrates a simplified metabolism that optimizes the use of scarce resources . S. alaskensis can exploit increases in ambient nutrient availability to achieve high-population densities .
KEGG: sal:Sala_2101
STRING: 317655.Sala_2101
Sphingopyxis alaskensis is a marine heterotrophic bacterium belonging to the Alphaproteobacteria class. It is an ultramicrobacterium with a cell volume less than 0.1 μm³, yet possesses a relatively large genome size of approximately 3.2 Mb . This organism is especially significant as it has been isolated as one of the most numerically abundant bacteria from Alaskan waters (strain RB2256), the North Sea, and the North Pacific (strain AFO1) over a period spanning ten years .
S. alaskensis is particularly important in marine ecosystem studies because:
It thrives in oligotrophic (nutrient-depleted) environments
It contributes significantly to marine microbial biomass
It plays a role in carbon sequestration processes
It demonstrates unique genetic and physiological properties fundamentally different from well-studied bacteria like Escherichia coli
The CrcB homolog protein in Sphingopyxis alaskensis is a membrane protein encoded by the crcB gene. Based on annotation information, it functions as a putative fluoride ion transporter . The protein consists of 126 amino acids (1-126 full length) and has been identified in various bacterial species with conserved functions .
The conserved domain architecture suggests that CrcB homologs typically form membrane-embedded structures involved in ion transport, particularly fluoride ions, which may serve as a protective mechanism against fluoride toxicity in bacteria. This putative function makes it an interesting target for studying ion homeostasis mechanisms in marine bacteria adapted to specific environmental conditions.
The recombinant S. alaskensis CrcB homolog protein has the following biochemical characteristics:
| Property | Description |
|---|---|
| Full Amino Acid Sequence | MNSLFPVMVGGAVGAGARHLVGQAMLARFGPGFPWWTLSVNIVGSLAM GLLIGLARGSGTGGETTRLFVGVGMLGGFTTFSSFSMEFWLLFERGQ SVQAGLYVVASVVGALLACGAGMILIRQLPA |
| UniProt ID | Q1GRB2 |
| Length | 126 amino acids (full-length) |
| Expression System | E. coli |
| Tag | His-tag (N-terminal in commercial preparations) |
| Solubility | Membrane protein, typically requires detergents for solubilization |
| Storage Buffer | Tris-based buffer with 50% glycerol, optimized for this protein |
| Storage Recommendations | -20°C to -80°C for extended storage; avoid repeated freeze-thaw cycles |
Based on amino acid composition analysis, the protein is highly hydrophobic with multiple predicted transmembrane domains, consistent with its putative role as an ion channel or transporter .
Based on established protocols for similar membrane proteins, the following methodological approach is recommended:
Expression Strategy:
Use E. coli BL21(DE3) or C41(DE3) strains, which are optimized for membrane protein expression
Clone the crcB gene into a vector containing an N-terminal His-tag (pET28a or similar)
Grow cultures at lower temperatures (16-22°C) after induction to promote proper folding
Use autoinduction media or controlled IPTG induction at lower concentrations (0.1-0.5 mM)
Purification Workflow:
Cell lysis: French press or sonication in buffer containing protease inhibitors
Membrane fraction isolation through differential centrifugation
Membrane protein solubilization using detergents (start with n-dodecyl-β-D-maltoside or LDAO)
Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin
Size exclusion chromatography for further purification
Critical Parameters:
Detergent concentration must be maintained above CMC throughout purification
Addition of 10-20% glycerol helps maintain protein stability
Consider using lipid nanodiscs or amphipols for downstream functional studies
When designing experiments to study CrcB function, researchers must carefully consider experimental design approaches:
Between-Subjects Design (recommended for):
Comparing wild-type vs. knockout phenotypes: Assign different bacterial cultures to either express or lack the CrcB protein
Testing environmental variables: Expose different cultures to varying fluoride concentrations
Toxicity studies: Assign different concentrations of potential inhibitors to separate cultures
In between-subjects designs, each experimental unit (bacterial culture) is tested in only one condition. This approach reduces carryover effects but requires larger sample sizes and careful randomization to ensure groups are comparable .
Within-Subjects Design (recommended for):
Time-course studies: Measuring ion flux in the same membrane preparation under sequential conditions
Dose-response relationships: Testing increasing concentrations of substrates on the same protein preparation
Comparative kinetics: Testing different ions on the same protein preparation
Within-subjects designs use the same experimental unit across multiple conditions, which increases statistical power but introduces potential carryover effects that must be controlled through counterbalancing and appropriate recovery periods .
Methodological Recommendation:
For initial functional characterization, a hybrid approach is often optimal:
Use between-subjects design for growth/viability studies
Use within-subjects design for direct biophysical measurements (ion flux)
Implement counterbalancing techniques when using the same protein preparation for multiple measurements
When designing functional studies of the S. alaskensis CrcB homolog, proper controls are crucial for valid interpretation of results. Consider implementing these control conditions:
Negative Controls:
Empty vector control: Cells transformed with the expression vector lacking the crcB gene
Inactive mutant control: Expression of site-directed mutants targeting conserved residues predicted to be essential for function
Unrelated membrane protein control: Expression of a membrane protein with different function to control for non-specific effects of membrane protein overexpression
Positive Controls:
Known functional CrcB homolog: Include a well-characterized CrcB homolog from another organism (e.g., E. coli CrcB)
Complementation control: Expressing S. alaskensis CrcB in a crcB knockout strain to rescue phenotype
Vehicle Controls:
Solvent controls for any compounds being tested (e.g., DMSO)
Equivalent concentrations of non-substrate ions to test specificity
Implementation Guidance:
Controls should be processed identically to experimental samples
Include time-matched controls when temporal changes are being measured
For between-subjects designs, use randomization to assign conditions
For comparative studies with other proteins, ensure equivalent expression levels
To investigate the ecological significance of CrcB in fluoride resistance in oligotrophic marine environments, researchers should consider this multi-faceted approach:
Field-to-Laboratory Pipeline:
Collect environmental samples from marine waters with varying natural fluoride concentrations
Quantify natural S. alaskensis populations using qPCR targeting species-specific markers
Isolate strains and assess their fluoride tolerance
Sequence crcB genes from environmental isolates to identify natural variants
Correlate crcB sequence variations with fluoride tolerance phenotypes
Functional Validation:
Create gene knockout strains using CRISPR-Cas9 or homologous recombination
Perform complementation studies with native and mutant versions of the crcB gene
Conduct growth inhibition assays under varying fluoride concentrations
Measure intracellular vs. extracellular fluoride concentrations using fluoride-selective electrodes
Mechanistic Investigation:
Reconstitute purified CrcB protein into liposomes for transport assays
Perform site-directed mutagenesis of conserved residues
Use fluorescent reporter systems to visualize fluoride flux in real-time
Employ patch-clamp electrophysiology to directly measure ion transport
This comprehensive approach combines ecological, genetic, and biochemical techniques to establish the physiological importance of CrcB in the oligotrophic lifestyle of S. alaskensis .
When conducting comparative studies of CrcB homologs across different bacterial species, researchers should implement the GRADE approach (Grading of Recommendations Assessment, Development and Evaluation) to assess the quality and certainty of evidence:
Evidence Quality Assessment Framework:
| Level of Certainty | Criteria for Assignment | Application to CrcB Research |
|---|---|---|
| High | Consistent results across multiple studies with low risk of bias | Multiple independent studies showing consistent function of CrcB homologs |
| Moderate | Some inconsistency or limitations in study design | Studies with different methodologies showing similar but not identical results |
| Low | Important limitations in study design, inconsistent results | Limited studies or significant methodological variations |
| Very Low | Serious limitations, very inconsistent results, or indirect evidence | Only computational predictions or single experimental approach |
Methodological Implementation:
Systematic literature review of all published CrcB homolog studies
Standardized data extraction protocol
Assessment of risk of bias in individual studies
Evaluation of inconsistency across studies
Consideration of indirectness of evidence
Assessment of imprecision in results
Evaluation of publication bias
Understanding the membrane topology of S. alaskensis CrcB requires specialized structural biology approaches suitable for membrane proteins:
Computational Prediction Methods:
Transmembrane domain prediction using multiple algorithms (TMHMM, Phobius, TOPCONS)
Evolutionary coupling analysis to identify co-evolving residue pairs
Homology modeling based on available structures of related proteins
Molecular dynamics simulations to assess stability of predicted conformations
Experimental Validation Techniques:
These approaches should be used in combination for comprehensive topology determination, starting with computational predictions to guide experimental design, followed by multiple orthogonal experimental techniques for validation .
Comparative sequence analysis reveals important insights about evolutionary conservation and potential functional differences between CrcB homologs:
Sequence Comparison Table:
| Species | UniProt ID | Length | Sequence Identity to S. alaskensis CrcB | Key Differences |
|---|---|---|---|---|
| Sphingopyxis alaskensis | Q1GRB2 | 126 aa | 100% | Reference sequence |
| Nitrosomonas europaea | Q82U09 | 127 aa | ~35% | Additional C-terminal residue; more hydrophilic residues in TM3 |
| Shewanella pealeana | A8H4R3 | 124 aa | ~42% | Two fewer residues; different N-terminal sequence |
Conserved Motifs:
GxGxVxFxxFS motif in predicted transmembrane domain 4 (100% conservation)
WxLSVN motif in predicted transmembrane domain 2 (high conservation)
FxxxGxxL motif at the C-terminus (moderate conservation)
Analysis of Variations:
The highest sequence variation occurs in the predicted cytoplasmic loops
Transmembrane domains show higher conservation, suggesting structural constraints
The putative substrate-binding site shows the highest degree of conservation
These patterns suggest strong selective pressure on the core transport function while allowing species-specific adaptations in regulatory regions, possibly reflecting adaptation to different ecological niches .
The presence of CrcB homologs in marine oligotrophic bacteria like S. alaskensis has important ecological implications:
Environmental Adaptation:
S. alaskensis is adapted to survive in nutrient-depleted (oligotrophic) marine environments where it must efficiently manage resources and defend against environmental stressors. The presence of a CrcB homolog, likely functioning as a fluoride ion transporter, suggests that fluoride toxicity may be an environmental challenge in marine ecosystems .
Metabolic Efficiency:
The retention of CrcB in the relatively streamlined genome of S. alaskensis (3.2 Mb compared to many larger bacterial genomes) suggests its importance for survival. As an ultramicrobacterium, S. alaskensis demonstrates a simplified metabolism where resources are carefully allocated. The maintenance of a fluoride exporter would represent a significant metabolic investment, indicating its essential nature .
Comparative Ecological Significance:
Studies of S. alaskensis have shown that, unlike some other oligotrophic bacteria like 'Candidatus Pelagibacter ubique' (SAR11 clade) which has a much smaller genome (1.31 Mb), S. alaskensis retains the ability to exploit increases in ambient nutrient availability and achieve high population densities. This adaptability may be supported by protective mechanisms like CrcB that enable survival across varying environmental conditions .
Biogeochemical Implications:
As one of the most abundant culturable bacteria in certain marine environments, S. alaskensis contributes significantly to marine carbon cycling. Understanding the role of CrcB in maintaining cellular homeostasis may provide insights into how these bacteria maintain their ecological functions in oligotrophic waters, which cover approximately 70% of the ocean surface .
To comprehensively understand CrcB regulation in S. alaskensis under varying environmental conditions, researchers should implement an integrated multi-omics approach:
Experimental Design Framework:
Environmental Condition Matrix:
Varying fluoride concentrations (0-10 mM)
Nutrient availability (oligotrophic vs. nutrient-rich)
Temperature variations (4-25°C)
Salinity gradients (mimicking coastal vs. open ocean)
Time-Course Sampling:
Short-term responses (minutes to hours)
Long-term adaptation (days to weeks)
Growth phase-specific sampling (lag, exponential, stationary)
Integrated Multi-Omics Pipeline:
Transcriptomics Approach:
RNA-Seq to quantify crcB mRNA levels
5' RACE to identify transcription start sites and promoter architecture
RNA stability assays to determine post-transcriptional regulation
RT-qPCR validation of key findings
Proteomics Approach:
Quantitative proteomics using LC-MS/MS
Membrane-enriched fractionation to enhance CrcB detection
Phosphoproteomics to identify potential regulatory modifications
Protein half-life measurements using pulse-chase experiments
Data Integration and Analysis:
Correlation analysis between transcript and protein levels
Network analysis to identify co-regulated genes/proteins
Comparison with known stress response pathways
Identification of potential transcriptional regulators
Validation Studies:
Reporter gene assays using crcB promoter fusions
ChIP-seq to identify transcription factor binding sites
CRISPR interference to validate regulatory relationships
Directed mutagenesis of putative regulatory elements
This comprehensive approach allows researchers to determine whether CrcB regulation occurs primarily at the transcriptional, post-transcriptional, or post-translational level, and how this regulation responds to environmental stressors relevant to the marine oligotrophic lifestyle of S. alaskensis .
Based on current knowledge gaps and technological advancements, several promising research directions emerge:
Single-Cell Studies:
Develop fluorescent reporters for tracking CrcB localization and activity in individual S. alaskensis cells
Apply microfluidics to study dynamic responses to environmental changes at the single-cell level
Investigate cell-to-cell variability in CrcB expression and function within populations
Environmental Metagenomics:
Survey crcB gene diversity across marine environmental gradients
Correlate natural variations in crcB sequences with environmental parameters
Identify potential horizontal gene transfer events involving crcB genes
Structural Biology:
Determine high-resolution structure of S. alaskensis CrcB using cryo-EM or X-ray crystallography
Identify substrate binding sites and conformational changes during transport
Develop structure-based inhibitors as research tools
Systems Biology Integration:
Develop mathematical models of fluoride homeostasis in oligotrophic bacteria
Integrate CrcB function into whole-cell models of S. alaskensis metabolism
Predict ecological consequences of CrcB function under changing marine conditions
These research directions will significantly advance our understanding of how specialized transporters like CrcB contribute to the ecological success of oligotrophic marine bacteria, with potential implications for understanding microbial adaptation to environmental stressors and predicting responses to changing ocean conditions .
As global climate change continues to alter marine ecosystems, the importance of CrcB function in marine microbes may shift in several ways:
Increased Ocean Acidification:
Ocean acidification resulting from increased atmospheric CO₂ may alter seawater chemistry, potentially affecting the speciation and bioavailability of fluoride ions. Changes in pH can affect ion equilibria, potentially increasing the proportion of HF (a more membrane-permeable form of fluoride) relative to F⁻ ions. This shift could increase the importance of fluoride exporters like CrcB for cellular protection .
Expanding Oligotrophic Zones:
Climate models predict expansion of oligotrophic regions in the oceans. As these nutrient-depleted zones increase in area, bacteria adapted to oligotrophic conditions, like S. alaskensis, may become more abundant. Understanding the role of CrcB in maintaining cellular homeostasis under these conditions may become increasingly important for predicting ecosystem functions .
Altered Marine Microbial Community Composition:
Changes in temperature, stratification, and nutrient availability are expected to shift microbial community compositions in marine environments. Species with efficient protective mechanisms against environmental stressors may gain competitive advantages. The presence and efficiency of transporters like CrcB could become important factors determining which species thrive in changing ocean conditions .
Potential Research Approaches:
Mesocosm experiments simulating future ocean conditions
Comparative genomics of CrcB across marine bacteria with different ecological strategies
Mathematical modeling of CrcB contribution to fitness under various climate scenarios
Experimental evolution studies under simulated future conditions