Recombinant Sphingopyxis alaskensis Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Sphingopyxis alaskensis Protein CrcB Homolog (CrcB)

Sphingopyxis alaskensis is a marine bacterium belonging to the Alphaproteobacteria class, known for its ability to thrive in nutrient-poor (oligotrophic) marine environments . The CrcB protein homolog in S. alaskensis is a protein that likely functions as a fluoride ion transporter .

General Information

CharacteristicDescription
SpeciesSphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
SynonymscrcB; Sala_2101
UniProt IDQ1GRB2
Molecular WeightApproximately 14.2 kDa (based on amino acid sequence)
FunctionPutative fluoride ion transporter
PurityGreater than 90% as determined by SDS-PAGE
SourceE. coli
TagHis tag (N-terminal)
AA SequenceMNSLFPVMVGGAVGAGARHLVGQAMLARFGPGFPWWTLSVNIVGSLAMGLLIGLLARSGTGGETTRLFVGVGMLGGFTTFSSFSMEFWLLFERGQSVQAGLYVVASVVGALLACGAGMILIRQLPA

Production and Characteristics

Recombinant CrcB homolog is produced in E. coli by introducing the crcB gene into E. coli cells, which then express the protein . The crcB gene in Sphingopyxis alaskensis is named Sala_2101 . The recombinant protein includes a His-tag, commonly used for purification purposes .

Function and Significance

  • Fluoride Transport: CrcB is a fluoride ion transporter, crucial for maintaining fluoride homeostasis within the cell .

  • Oligotrophic Adaptation: Sphingopyxis alaskensis thrives in oligotrophic environments, demonstrating unique genetic and physiological properties different from well-studied bacteria like Escherichia coli .

Sphingopyxis alaskensis Ecology and Metabolism

Sphingopyxis alaskensis is adapted to heterotrophic growth in nutrient-depleted conditions and can utilize specific amino acids and putrescine as sole carbon and nitrogen sources . It demonstrates a simplified metabolism that optimizes the use of scarce resources . S. alaskensis can exploit increases in ambient nutrient availability to achieve high-population densities .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
crcB; Sala_2101; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-126
Protein Length
full length protein
Species
Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) (Sphingomonas alaskensis)
Target Names
crcB
Target Protein Sequence
MNSLFPVMVGGAVGAGARHLVGQAMLARFGPGFPWWTLSVNIVGSLAMGLLIGLLARSGT GGETTRLFVGVGMLGGFTTFSSFSMEFWLLFERGQSVQAGLYVVASVVGALLACGAGMIL IRQLPA
Uniprot No.

Target Background

Function
Crucial in reducing intracellular fluoride concentration, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Sphingopyxis alaskensis and why is it significant in marine microbiology?

Sphingopyxis alaskensis is a marine heterotrophic bacterium belonging to the Alphaproteobacteria class. It is an ultramicrobacterium with a cell volume less than 0.1 μm³, yet possesses a relatively large genome size of approximately 3.2 Mb . This organism is especially significant as it has been isolated as one of the most numerically abundant bacteria from Alaskan waters (strain RB2256), the North Sea, and the North Pacific (strain AFO1) over a period spanning ten years .

S. alaskensis is particularly important in marine ecosystem studies because:

  • It thrives in oligotrophic (nutrient-depleted) environments

  • It contributes significantly to marine microbial biomass

  • It plays a role in carbon sequestration processes

  • It demonstrates unique genetic and physiological properties fundamentally different from well-studied bacteria like Escherichia coli

What is the CrcB homolog protein and what is its putative function?

The CrcB homolog protein in Sphingopyxis alaskensis is a membrane protein encoded by the crcB gene. Based on annotation information, it functions as a putative fluoride ion transporter . The protein consists of 126 amino acids (1-126 full length) and has been identified in various bacterial species with conserved functions .

The conserved domain architecture suggests that CrcB homologs typically form membrane-embedded structures involved in ion transport, particularly fluoride ions, which may serve as a protective mechanism against fluoride toxicity in bacteria. This putative function makes it an interesting target for studying ion homeostasis mechanisms in marine bacteria adapted to specific environmental conditions.

What are the biochemical characteristics of recombinant S. alaskensis CrcB homolog?

The recombinant S. alaskensis CrcB homolog protein has the following biochemical characteristics:

PropertyDescription
Full Amino Acid SequenceMNSLFPVMVGGAVGAGARHLVGQAMLARFGPGFPWWTLSVNIVGSLAM GLLIGLARGSGTGGETTRLFVGVGMLGGFTTFSSFSMEFWLLFERGQ SVQAGLYVVASVVGALLACGAGMILIRQLPA
UniProt IDQ1GRB2
Length126 amino acids (full-length)
Expression SystemE. coli
TagHis-tag (N-terminal in commercial preparations)
SolubilityMembrane protein, typically requires detergents for solubilization
Storage BufferTris-based buffer with 50% glycerol, optimized for this protein
Storage Recommendations-20°C to -80°C for extended storage; avoid repeated freeze-thaw cycles

Based on amino acid composition analysis, the protein is highly hydrophobic with multiple predicted transmembrane domains, consistent with its putative role as an ion channel or transporter .

What are the optimal expression and purification strategies for recombinant S. alaskensis CrcB homolog?

Based on established protocols for similar membrane proteins, the following methodological approach is recommended:

Expression Strategy:

  • Use E. coli BL21(DE3) or C41(DE3) strains, which are optimized for membrane protein expression

  • Clone the crcB gene into a vector containing an N-terminal His-tag (pET28a or similar)

  • Grow cultures at lower temperatures (16-22°C) after induction to promote proper folding

  • Use autoinduction media or controlled IPTG induction at lower concentrations (0.1-0.5 mM)

Purification Workflow:

  • Cell lysis: French press or sonication in buffer containing protease inhibitors

  • Membrane fraction isolation through differential centrifugation

  • Membrane protein solubilization using detergents (start with n-dodecyl-β-D-maltoside or LDAO)

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Size exclusion chromatography for further purification

Critical Parameters:

  • Detergent concentration must be maintained above CMC throughout purification

  • Addition of 10-20% glycerol helps maintain protein stability

  • Consider using lipid nanodiscs or amphipols for downstream functional studies

How should researchers design between-subjects vs. within-subjects experiments when studying CrcB function?

When designing experiments to study CrcB function, researchers must carefully consider experimental design approaches:

Between-Subjects Design (recommended for):

  • Comparing wild-type vs. knockout phenotypes: Assign different bacterial cultures to either express or lack the CrcB protein

  • Testing environmental variables: Expose different cultures to varying fluoride concentrations

  • Toxicity studies: Assign different concentrations of potential inhibitors to separate cultures

In between-subjects designs, each experimental unit (bacterial culture) is tested in only one condition. This approach reduces carryover effects but requires larger sample sizes and careful randomization to ensure groups are comparable .

Within-Subjects Design (recommended for):

  • Time-course studies: Measuring ion flux in the same membrane preparation under sequential conditions

  • Dose-response relationships: Testing increasing concentrations of substrates on the same protein preparation

  • Comparative kinetics: Testing different ions on the same protein preparation

Within-subjects designs use the same experimental unit across multiple conditions, which increases statistical power but introduces potential carryover effects that must be controlled through counterbalancing and appropriate recovery periods .

Methodological Recommendation:
For initial functional characterization, a hybrid approach is often optimal:

  • Use between-subjects design for growth/viability studies

  • Use within-subjects design for direct biophysical measurements (ion flux)

  • Implement counterbalancing techniques when using the same protein preparation for multiple measurements

What are the appropriate control conditions for functional studies of the CrcB homolog?

When designing functional studies of the S. alaskensis CrcB homolog, proper controls are crucial for valid interpretation of results. Consider implementing these control conditions:

Negative Controls:

  • Empty vector control: Cells transformed with the expression vector lacking the crcB gene

  • Inactive mutant control: Expression of site-directed mutants targeting conserved residues predicted to be essential for function

  • Unrelated membrane protein control: Expression of a membrane protein with different function to control for non-specific effects of membrane protein overexpression

Positive Controls:

  • Known functional CrcB homolog: Include a well-characterized CrcB homolog from another organism (e.g., E. coli CrcB)

  • Complementation control: Expressing S. alaskensis CrcB in a crcB knockout strain to rescue phenotype

Vehicle Controls:

  • Solvent controls for any compounds being tested (e.g., DMSO)

  • Equivalent concentrations of non-substrate ions to test specificity

Implementation Guidance:

  • Controls should be processed identically to experimental samples

  • Include time-matched controls when temporal changes are being measured

  • For between-subjects designs, use randomization to assign conditions

  • For comparative studies with other proteins, ensure equivalent expression levels

How can researchers assess the role of S. alaskensis CrcB homolog in fluoride resistance in oligotrophic environments?

To investigate the ecological significance of CrcB in fluoride resistance in oligotrophic marine environments, researchers should consider this multi-faceted approach:

Field-to-Laboratory Pipeline:

  • Collect environmental samples from marine waters with varying natural fluoride concentrations

  • Quantify natural S. alaskensis populations using qPCR targeting species-specific markers

  • Isolate strains and assess their fluoride tolerance

  • Sequence crcB genes from environmental isolates to identify natural variants

  • Correlate crcB sequence variations with fluoride tolerance phenotypes

Functional Validation:

  • Create gene knockout strains using CRISPR-Cas9 or homologous recombination

  • Perform complementation studies with native and mutant versions of the crcB gene

  • Conduct growth inhibition assays under varying fluoride concentrations

  • Measure intracellular vs. extracellular fluoride concentrations using fluoride-selective electrodes

Mechanistic Investigation:

  • Reconstitute purified CrcB protein into liposomes for transport assays

  • Perform site-directed mutagenesis of conserved residues

  • Use fluorescent reporter systems to visualize fluoride flux in real-time

  • Employ patch-clamp electrophysiology to directly measure ion transport

This comprehensive approach combines ecological, genetic, and biochemical techniques to establish the physiological importance of CrcB in the oligotrophic lifestyle of S. alaskensis .

How do researchers assess the quality and certainty of evidence in comparative studies of CrcB homologs across bacterial species?

When conducting comparative studies of CrcB homologs across different bacterial species, researchers should implement the GRADE approach (Grading of Recommendations Assessment, Development and Evaluation) to assess the quality and certainty of evidence:

Evidence Quality Assessment Framework:

Level of CertaintyCriteria for AssignmentApplication to CrcB Research
HighConsistent results across multiple studies with low risk of biasMultiple independent studies showing consistent function of CrcB homologs
ModerateSome inconsistency or limitations in study designStudies with different methodologies showing similar but not identical results
LowImportant limitations in study design, inconsistent resultsLimited studies or significant methodological variations
Very LowSerious limitations, very inconsistent results, or indirect evidenceOnly computational predictions or single experimental approach

Methodological Implementation:

  • Systematic literature review of all published CrcB homolog studies

  • Standardized data extraction protocol

  • Assessment of risk of bias in individual studies

  • Evaluation of inconsistency across studies

  • Consideration of indirectness of evidence

  • Assessment of imprecision in results

  • Evaluation of publication bias

What advanced structural biology approaches are most suitable for determining the membrane topology of S. alaskensis CrcB?

Understanding the membrane topology of S. alaskensis CrcB requires specialized structural biology approaches suitable for membrane proteins:

Computational Prediction Methods:

  • Transmembrane domain prediction using multiple algorithms (TMHMM, Phobius, TOPCONS)

  • Evolutionary coupling analysis to identify co-evolving residue pairs

  • Homology modeling based on available structures of related proteins

  • Molecular dynamics simulations to assess stability of predicted conformations

Experimental Validation Techniques:

These approaches should be used in combination for comprehensive topology determination, starting with computational predictions to guide experimental design, followed by multiple orthogonal experimental techniques for validation .

How does the amino acid sequence of S. alaskensis CrcB compare with homologs from other bacterial species?

Comparative sequence analysis reveals important insights about evolutionary conservation and potential functional differences between CrcB homologs:

Sequence Comparison Table:

SpeciesUniProt IDLengthSequence Identity to S. alaskensis CrcBKey Differences
Sphingopyxis alaskensisQ1GRB2126 aa100%Reference sequence
Nitrosomonas europaeaQ82U09127 aa~35%Additional C-terminal residue; more hydrophilic residues in TM3
Shewanella pealeanaA8H4R3124 aa~42%Two fewer residues; different N-terminal sequence

Conserved Motifs:

  • GxGxVxFxxFS motif in predicted transmembrane domain 4 (100% conservation)

  • WxLSVN motif in predicted transmembrane domain 2 (high conservation)

  • FxxxGxxL motif at the C-terminus (moderate conservation)

Analysis of Variations:

  • The highest sequence variation occurs in the predicted cytoplasmic loops

  • Transmembrane domains show higher conservation, suggesting structural constraints

  • The putative substrate-binding site shows the highest degree of conservation

These patterns suggest strong selective pressure on the core transport function while allowing species-specific adaptations in regulatory regions, possibly reflecting adaptation to different ecological niches .

What is the ecological significance of CrcB homologs in marine oligotrophic bacteria like S. alaskensis?

The presence of CrcB homologs in marine oligotrophic bacteria like S. alaskensis has important ecological implications:

Environmental Adaptation:
S. alaskensis is adapted to survive in nutrient-depleted (oligotrophic) marine environments where it must efficiently manage resources and defend against environmental stressors. The presence of a CrcB homolog, likely functioning as a fluoride ion transporter, suggests that fluoride toxicity may be an environmental challenge in marine ecosystems .

Metabolic Efficiency:
The retention of CrcB in the relatively streamlined genome of S. alaskensis (3.2 Mb compared to many larger bacterial genomes) suggests its importance for survival. As an ultramicrobacterium, S. alaskensis demonstrates a simplified metabolism where resources are carefully allocated. The maintenance of a fluoride exporter would represent a significant metabolic investment, indicating its essential nature .

Comparative Ecological Significance:
Studies of S. alaskensis have shown that, unlike some other oligotrophic bacteria like 'Candidatus Pelagibacter ubique' (SAR11 clade) which has a much smaller genome (1.31 Mb), S. alaskensis retains the ability to exploit increases in ambient nutrient availability and achieve high population densities. This adaptability may be supported by protective mechanisms like CrcB that enable survival across varying environmental conditions .

Biogeochemical Implications:
As one of the most abundant culturable bacteria in certain marine environments, S. alaskensis contributes significantly to marine carbon cycling. Understanding the role of CrcB in maintaining cellular homeostasis may provide insights into how these bacteria maintain their ecological functions in oligotrophic waters, which cover approximately 70% of the ocean surface .

How can researchers integrate transcriptomic and proteomic approaches to study CrcB regulation in S. alaskensis under different environmental conditions?

To comprehensively understand CrcB regulation in S. alaskensis under varying environmental conditions, researchers should implement an integrated multi-omics approach:

Experimental Design Framework:

  • Environmental Condition Matrix:

    • Varying fluoride concentrations (0-10 mM)

    • Nutrient availability (oligotrophic vs. nutrient-rich)

    • Temperature variations (4-25°C)

    • Salinity gradients (mimicking coastal vs. open ocean)

  • Time-Course Sampling:

    • Short-term responses (minutes to hours)

    • Long-term adaptation (days to weeks)

    • Growth phase-specific sampling (lag, exponential, stationary)

Integrated Multi-Omics Pipeline:

  • Transcriptomics Approach:

    • RNA-Seq to quantify crcB mRNA levels

    • 5' RACE to identify transcription start sites and promoter architecture

    • RNA stability assays to determine post-transcriptional regulation

    • RT-qPCR validation of key findings

  • Proteomics Approach:

    • Quantitative proteomics using LC-MS/MS

    • Membrane-enriched fractionation to enhance CrcB detection

    • Phosphoproteomics to identify potential regulatory modifications

    • Protein half-life measurements using pulse-chase experiments

  • Data Integration and Analysis:

    • Correlation analysis between transcript and protein levels

    • Network analysis to identify co-regulated genes/proteins

    • Comparison with known stress response pathways

    • Identification of potential transcriptional regulators

  • Validation Studies:

    • Reporter gene assays using crcB promoter fusions

    • ChIP-seq to identify transcription factor binding sites

    • CRISPR interference to validate regulatory relationships

    • Directed mutagenesis of putative regulatory elements

This comprehensive approach allows researchers to determine whether CrcB regulation occurs primarily at the transcriptional, post-transcriptional, or post-translational level, and how this regulation responds to environmental stressors relevant to the marine oligotrophic lifestyle of S. alaskensis .

What are the most promising research directions for understanding CrcB function in marine oligotrophic bacteria?

Based on current knowledge gaps and technological advancements, several promising research directions emerge:

  • Single-Cell Studies:

    • Develop fluorescent reporters for tracking CrcB localization and activity in individual S. alaskensis cells

    • Apply microfluidics to study dynamic responses to environmental changes at the single-cell level

    • Investigate cell-to-cell variability in CrcB expression and function within populations

  • Environmental Metagenomics:

    • Survey crcB gene diversity across marine environmental gradients

    • Correlate natural variations in crcB sequences with environmental parameters

    • Identify potential horizontal gene transfer events involving crcB genes

  • Structural Biology:

    • Determine high-resolution structure of S. alaskensis CrcB using cryo-EM or X-ray crystallography

    • Identify substrate binding sites and conformational changes during transport

    • Develop structure-based inhibitors as research tools

  • Systems Biology Integration:

    • Develop mathematical models of fluoride homeostasis in oligotrophic bacteria

    • Integrate CrcB function into whole-cell models of S. alaskensis metabolism

    • Predict ecological consequences of CrcB function under changing marine conditions

These research directions will significantly advance our understanding of how specialized transporters like CrcB contribute to the ecological success of oligotrophic marine bacteria, with potential implications for understanding microbial adaptation to environmental stressors and predicting responses to changing ocean conditions .

How might climate change impact the importance of CrcB function in marine microbial communities?

As global climate change continues to alter marine ecosystems, the importance of CrcB function in marine microbes may shift in several ways:

Increased Ocean Acidification:
Ocean acidification resulting from increased atmospheric CO₂ may alter seawater chemistry, potentially affecting the speciation and bioavailability of fluoride ions. Changes in pH can affect ion equilibria, potentially increasing the proportion of HF (a more membrane-permeable form of fluoride) relative to F⁻ ions. This shift could increase the importance of fluoride exporters like CrcB for cellular protection .

Expanding Oligotrophic Zones:
Climate models predict expansion of oligotrophic regions in the oceans. As these nutrient-depleted zones increase in area, bacteria adapted to oligotrophic conditions, like S. alaskensis, may become more abundant. Understanding the role of CrcB in maintaining cellular homeostasis under these conditions may become increasingly important for predicting ecosystem functions .

Altered Marine Microbial Community Composition:
Changes in temperature, stratification, and nutrient availability are expected to shift microbial community compositions in marine environments. Species with efficient protective mechanisms against environmental stressors may gain competitive advantages. The presence and efficiency of transporters like CrcB could become important factors determining which species thrive in changing ocean conditions .

Potential Research Approaches:

  • Mesocosm experiments simulating future ocean conditions

  • Comparative genomics of CrcB across marine bacteria with different ecological strategies

  • Mathematical modeling of CrcB contribution to fitness under various climate scenarios

  • Experimental evolution studies under simulated future conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.