Recombinant Sphingopyxis alaskensis UPF0314 protein Sala_3154 (Sala_3154)

What is the Sphingopyxis alaskensis UPF0314 protein Sala_3154?

The UPF0314 protein Sala_3154 is a full-length protein (188 amino acids) from Sphingopyxis alaskensis strain DSM 13593/LMG 18877/RB2256, with UniProt accession number Q1GNB5. This protein belongs to the UPF0314 family of uncharacterized proteins with predicted membrane localization. The amino acid sequence (MVGGISRTGWLVAAALVALLAAILIFMGRPPICPCGTVSLWHGTVQSNQNSQQISDWYSF SHIIHGFIFYGVLRWIMPERALWVPLAIAIGTEGAWEILENSPLIIDRYREVTMAFGYSG DSVLNSVSDTLFMVAGFLAAGRMRWWVTAALAIAFELFTLWTIRDNLTLNVLmLVSPVEA IKDWQAGG) contains hydrophobic regions consistent with transmembrane domains, suggesting a potential role in membrane-associated functions .

What is the source organism Sphingopyxis alaskensis and why is it significant for research?

Sphingopyxis alaskensis is a marine alphaproteobacterium that thrives in nutrient-depleted (oligotrophic) environments. Specifically, S. alaskensis strain RB2256 is classified as an ultramicrobacterium with a cell volume less than 0.1 μm³, yet possesses a relatively large genome of 3.35 Mbp compared to other oligotrophic ultramicrobacteria like 'Candidatus Pelagibacter ubique' HTCC1062 (1.31 Mbp) . The organism was isolated as one of the most numerically abundant bacteria from Alaskan waters, the North Sea, and the North Pacific over a ten-year sampling period, indicating its significant contribution to microbial biomass in these marine environments .

The ecological importance and unique adaptations of S. alaskensis to oligotrophic conditions make it an excellent model organism for studying bacterial survival strategies in nutrient-limited environments, which comprise the majority of the ocean's surface. Understanding its physiology has implications for modeling marine ecosystems and their responses to climate change, as increased ocean oligotrophy is predicted with global warming .

How should recombinant Sala_3154 protein be stored for optimal stability?

For optimal stability of recombinant Sala_3154 protein, the following storage protocol is recommended:

• Store at -20°C for regular use

• For extended storage, conserve at -20°C or -80°C

• Prepare working aliquots and store at 4°C for up to one week

• Avoid repeated freezing and thawing cycles as this may compromise protein integrity

The protein is typically supplied in a Tris-based buffer with 50% glycerol, which has been optimized for this specific protein's stability . The high glycerol content serves as a cryoprotectant that prevents ice crystal formation during freezing, which could otherwise damage the protein structure.

What are the predicted structural and functional characteristics of the UPF0314 protein Sala_3154?

Based on sequence analysis, the UPF0314 protein Sala_3154 displays several key structural features:

The protein contains the sequence motif "PPICPCGTVSLWHG" which includes a conserved CPCG pattern that may be involved in metal coordination or catalytic activity . The predominance of hydrophobic amino acids and predicted transmembrane domains suggests integration into the bacterial cell membrane, potentially involved in:

• Small molecule transport

• Signal transduction

• Membrane structural integrity

• Response to environmental stressors

Given S. alaskensis' adaptation to oligotrophic environments, this protein may play a role in nutrient acquisition or stress response mechanisms that contribute to the organism's ability to thrive under nutrient limitation .

How does the expression of Sala_3154 relate to S. alaskensis' adaptation to oligotrophic conditions?

The expression of Sala_3154 likely correlates with S. alaskensis' sophisticated adaptations to nutrient-limited environments. While specific expression data for this protein is not provided in the search results, several contextual insights can be inferred:

S. alaskensis displays a simplified metabolism where the fate of certain substrates is constrained, especially at the intersections of central carbon and nitrogen metabolism, ensuring optimal allocation of scarce resources . The UPF0314 protein Sala_3154, as a predicted membrane protein, may participate in this optimized resource allocation through:

• Enhanced substrate affinity transport systems for capturing low-concentration nutrients

• Specialized signaling mechanisms that detect minute changes in nutrient availability

• Structural adaptations that contribute to the ultramicrobacterial phenotype

Unlike some other oligotrophic bacteria such as those in the SAR11 clade, S. alaskensis has retained the physiological capacity to exploit increases in ambient nutrient availability and achieve high population densities . This metabolic flexibility might involve regulated expression of proteins like Sala_3154 in response to changing environmental conditions.

What experimental approaches are most effective for functional characterization of UPF0314 family proteins like Sala_3154?

For comprehensive functional characterization of UPF0314 family proteins such as Sala_3154, a multi-faceted experimental approach is recommended:

• Genetic manipulation strategies:

  • Gene knockout/knockdown using CRISPR-Cas systems adapted for S. alaskensis

  • Complementation studies with wild-type and mutant versions

  • Conditional expression systems to control protein levels

• Protein localization and interaction studies:

  • Fluorescent protein tagging for in vivo localization

  • Membrane fractionation coupled with western blotting

  • Crosslinking mass spectrometry to identify protein partners

  • Co-immunoprecipitation with suspected interaction partners

• Functional assays:

  • Growth phenotyping under various nutrient limitations

  • Membrane permeability assays

  • Transport studies with labeled substrates

  • Stress response measurements (oxidative, osmotic, temperature)

• Structural biology approaches:

  • X-ray crystallography or cryo-EM for 3D structure determination

  • NMR for dynamic structural information and ligand binding

  • Molecular dynamics simulations based on structural data

Given the membrane-associated nature of this protein, techniques like native nanodiscs or styrene maleic acid lipid particles (SMALPs) may be particularly valuable for maintaining the protein in a native-like lipid environment during purification and characterization .

What are the optimal expression and purification conditions for recombinant Sala_3154?

Optimizing expression and purification of recombinant Sala_3154 requires careful consideration of its membrane-associated nature. The following protocol elements are recommended:

Expression system selection:

• Bacterial systems: E. coli with specialized strains for membrane proteins (C41, C43)

• Yeast systems: Pichia pastoris or Saccharomyces cerevisiae for eukaryotic expression

• Cell-free systems: For difficult-to-express toxic membrane proteins

Expression optimization parameters:

Purification strategy:

• Membrane fraction isolation via ultracentrifugation

• Solubilization using mild detergents (DDM, LMNG, or digitonin)

• Affinity chromatography with appropriate tags (His, FLAG, or customized tag)

• Size exclusion chromatography for final polishing

• Buffer optimization with glycerol (20-50%) for stability

For structural studies, consider reconstitution into nanodiscs or liposomes to maintain native-like lipid environment and protein functionality.

How can researchers effectively study protein-protein interactions involving Sala_3154?

To effectively study protein-protein interactions (PPIs) involving the membrane-associated Sala_3154 protein, specialized approaches are required:

In vivo approaches:

• Bacterial two-hybrid systems modified for membrane proteins:

  • Split-ubiquitin system

  • BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system optimized for membrane proteins

• Proximity-based labeling methods:

  • BioID or TurboID fusion proteins

  • APEX2 peroxidase proximity labeling

• FRET/BRET assays:

  • Fusion constructs with appropriate fluorescent protein pairs

  • Live-cell monitoring of interactions

In vitro approaches:

• Co-immunoprecipitation with specialized detergents:

  • Digitonin or lauryl maltose neopentyl glycol (LMNG)

  • Crosslinking prior to solubilization to capture transient interactions

• Label transfer methods:

  • PhotoMet labeling

  • Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC) hetero-bifunctional crosslinking

• Surface Plasmon Resonance (SPR) with membrane mimetics:

  • Liposome capture on L1 chip

  • Nanodisc immobilization strategies

Analysis methods:

• Mass spectrometry-based identification:

  • SWATH-MS for quantitative interactome analysis

  • Crosslink-MS to identify interaction interfaces

• Validation approaches:

  • Reciprocal co-immunoprecipitation

  • Mutational analysis of binding interfaces

  • Competition assays with synthetic peptides

Given S. alaskensis' oligotrophic nature, particular attention should be paid to interactions that might occur only under specific nutrient limitation conditions, requiring carefully designed experimental conditions that mimic the organism's natural environment .

What control experiments are essential when studying the function of Sala_3154 in S. alaskensis?

When investigating the function of Sala_3154 in S. alaskensis, the following control experiments are essential to ensure reliable and interpretable results:

Genetic controls:

• Complete gene deletion mutant: To establish a clear phenotype baseline

• Complementation controls: Wild-type protein expression in the deletion background

• Point mutation controls: Conservative and non-conservative mutations in key predicted functional domains

• Expression level controls: Confirm that phenotypic effects are not due to over/under-expression artifacts

Physiological controls:

• Growth condition contrasts:

  • Oligotrophic vs. nutrient-rich conditions

  • Different carbon and nitrogen sources (particularly alanine)

  • Temperature variations (4-10°C vs. higher temperatures)

• Stress response comparisons:

  • Oxidative stress (H₂O₂, paraquat)

  • Osmotic stress (varying salt concentrations)

  • pH stress

Biochemical controls:

• Protein preparation controls:

  • Empty vector preparations processed identically to Sala_3154

  • Heat-inactivated protein samples

  • Properly folded vs. denatured protein comparisons

• Interaction specificity controls:

  • Unrelated membrane proteins from S. alaskensis

  • Homologous proteins from non-oligotrophic bacteria

Bioinformatic controls:

• Comparative analysis with UPF0314 proteins from:

  • Other oligotrophic bacteria

  • Closely related non-oligotrophic Sphingomonadaceae

  • Distantly related bacteria with similar ecological niches

These multi-level controls help distinguish specific functions of Sala_3154 from general cellular responses and provide context for interpreting the protein's role in S. alaskensis' adaptation to oligotrophic environments .

How might understanding Sala_3154 contribute to climate change research?

Understanding the function of Sala_3154 in Sphingopyxis alaskensis may provide valuable insights for climate change research through several interconnected pathways:

Carbon cycling implications:
S. alaskensis plays a role in marine carbon cycling as a heterotrophic bacterium in oligotrophic environments. The ocean's capacity for carbon sequestration is significantly influenced by the balance between particle degradation (which regenerates CO₂ via respiration) and burial in marine sediments . As oligotrophic conditions are forecast to increase with global warming, understanding proteins like Sala_3154 that may be involved in S. alaskensis' resource acquisition and metabolic efficiency could help predict:

• Changes in bacterial community composition in response to warming oceans

• Alterations in marine carbon flux dynamics

• Shifts in nutrient cycling in increasingly stratified ocean systems

Ecosystem modeling applications:
Detailed understanding of Sala_3154's function could improve the parameterization of:

• Biogeochemical models that simulate carbon and nitrogen fluxes

• Ecosystem models that predict interdependencies between phytoplankton, bacteria, and higher trophic levels

• Global climate models that incorporate marine carbon cycling

Biotechnological applications for climate mitigation:
If Sala_3154 is involved in efficient resource utilization under oligotrophic conditions, understanding its mechanisms could inspire:

• Development of enhanced carbon capture systems based on biological principles

• Design of synthetic microbial communities for environmental remediation

• Engineering of climate-resilient beneficial microorganisms

By linking molecular-level understanding of proteins like Sala_3154 to ecosystem-level processes, researchers can build more accurate predictive models of how marine systems will respond to and influence climate change .

What insights might Sala_3154 provide for understanding bacterial adaptation to extreme environments?

Sala_3154 represents an opportunity to gain fundamental insights into bacterial adaptation mechanisms to extreme environments, particularly nutrient limitation:

Evolutionary adaptation strategies:
The UPF0314 protein Sala_3154 may exemplify specialized adaptations that enable survival in oligotrophic conditions. Studying this protein could reveal:

• Molecular innovations that facilitate resource acquisition in extreme nutrient limitation

• Evolutionary trade-offs between metabolic versatility and efficiency

• Comparative genomic patterns among bacteria adapted to different extreme environments

Mechanistic insights into oligotrophy:
S. alaskensis displays a simplified yet specialized metabolism optimized for scarce resource environments . Sala_3154 might participate in:

• High-affinity transport systems for limiting nutrients

• Sensory mechanisms that detect subtle environmental changes

• Energy conservation strategies unique to oligotrophic bacteria

Ultramicrobacterial physiology:
The ultramicrobacterial phenotype (cell volume <0.1 μm³) of S. alaskensis represents an adaptation to maximize surface-to-volume ratio in nutrient-poor environments . Sala_3154 could contribute to:

• Membrane organization strategies that maintain functionality in minimized cells

• Specialized signaling pathways that coordinate responses to environmental fluctuations

• Structural components that enable extreme cell size reduction while maintaining viability

Comparative adaptation frameworks:
S. alaskensis differs from other oligotrophic bacteria like the SAR11 clade in its ability to exploit increases in ambient nutrients and achieve high population densities . Understanding Sala_3154 could help explain:

• The molecular basis for this metabolic flexibility

• Different evolutionary strategies for oligotrophy

• Niche partitioning among marine bacteria in changing environments

These insights could extend beyond marine environments to inform our understanding of bacterial adaptation to other extreme conditions, including those relevant to astrobiology, biotechnology, and medical microbiology .