Recombinant Spinacia oleracea 37 kDa inner envelope membrane protein, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
2-methyl-6-phytyl-1,4-hydroquinone methyltransferase, chloroplastic; 37 kDa inner envelope membrane protein; E37; MPBQ/MSBQ methyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-344
Protein Length
Full Length of Mature Protein
Species
Spinacia oleracea (Spinach)
Target Protein Sequence
RLRFSGSDFTGSYKLPRLNLPPNSRNLRAKTLTTVTKCTLSASERPASQPRFIQNKQEAF WFYRFLSIVYDNIINPGHWTEDMRDVALEPADLNNRNMLVVDVGGGTGFTTLGIIKHVDP KNVTILDQSPHQLAKAKAKKPLKECRIIEGDAEDLPFPTDYADRYVSAGSIEYWPDPQRG IREAYRVLKLGGKACLIGPVYPTFWLSRFFADVWMLFPKEEEYIEWFQKAGFKDVQLKRI GPKWYRGVRRHGLIMGCSVTGVKPASGDSPLQLGPKVEDVQKPVHPLVFLYRFLLGALAS TYYVLVPIYMWIKDKIFPKGMPL
Uniprot No.

Target Background

Function

This protein plays a crucial role in the methylation step of both tocopherol (vitamin E) and plastoquinone biosynthesis. It catalyzes the conversion of 2-methyl-6-phytyl-1,4-hydroquinone (MPBQ) to 2,3-dimethyl-6-phytyl-1,4-hydroquinone (DMPQ, a tocopherol cyclase substrate), and 2-methyl-6-solanyl-1,4-benzoquinone (MSBQ) to plastoquinone.

Protein Families
Class I-like SAM-binding methyltransferase superfamily, MPBQ/MBSQ MT family
Subcellular Location
Plastid, chloroplast inner membrane; Single-pass membrane protein.

Q&A

What is the Spinacia oleracea 37 kDa inner envelope membrane protein and what is its function?

The 37 kDa inner envelope membrane protein from spinach chloroplasts (also known as MPBQ/MSBQ methyltransferase, UniProt ID: P23525) is an integral component of the chloroplast inner envelope membrane. Functionally, it serves as a 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase involved in plastoquinone and tocopherol biosynthesis pathways .

The protein is synthesized as a precursor of 344 amino acids (Mr 38,976) in the cytosol and contains a transit peptide of 21 amino acid residues that directs the protein to chloroplasts . It plays a critical role in chloroplast envelope function, which serves as the permeability barrier between the stroma and the cytoplasm .

How is the 37 kDa protein localized within the chloroplast envelope?

The spinach 37 kDa protein is specifically localized to the inner envelope membrane of chloroplasts . Research using Western blot analysis has confirmed this localization pattern. Topological studies have revealed that it is a monotopic enzyme, embedded within one leaflet of the inner envelope membrane rather than spanning the entire membrane multiple times .

What is known about the transit peptide of the spinach 37 kDa inner envelope membrane protein?

The transit peptide of this protein has several notable characteristics:

  • Length: 21 amino acid residues

  • Structure: Forms an amphiphilic α-helix with a strong hydrophobic moment

  • Function: Directs the protein to the chloroplast but contains only stroma-targeting information

  • Evolutionary significance: It has been speculated that this structural element represents an ancestral envelope-targeting domain

Unlike transit peptides for thylakoid proteins, this transit peptide only contains signals for transport across the envelope membranes, not for further sorting to other chloroplast compartments . The information for integration into the envelope membrane is contained in the mature part of the protein, particularly in hydrophobic domains .

What are the recommended protocols for isolation and purification of the recombinant spinach 37 kDa inner envelope membrane protein?

For isolation and purification of recombinant Spinacia oleracea 37 kDa inner envelope membrane protein:

  • Expression system: Use E. coli expression systems with a His-tag fusion for easy purification

  • Purification method: Use affinity chromatography (Ni-NTA) followed by size exclusion chromatography

  • Buffer conditions: Tris/PBS-based buffer, pH 8.0, with 6% Trehalose as a stabilizer

  • Storage conditions: Store lyophilized at -20°C/-80°C; for working aliquots, reconstitute to 0.1-1.0 mg/mL and add 5-50% glycerol for long-term storage at -20°C/-80°C

  • Quality control: Verify purity via SDS-PAGE (>90% purity)

For isolation of native envelope membranes containing the protein:

  • Source material: Fresh spinach leaves

  • Isolation technique: Floatation centrifugation followed by sedimentation sucrose density gradient centrifugation after disruption of intact chloroplasts by freezing and thawing

  • Fractionation: Separate inner and outer envelope membranes based on buoyant density (inner envelope at 1.11 g/cm³, outer envelope at 1.08 g/cm³)

  • Verification: Analyze polypeptide composition by high-resolution SDS-PAGE and N-terminal sequencing

How can researchers perform effective in vitro import studies with this protein?

For conducting in vitro import studies with the spinach 37 kDa inner envelope membrane protein:

  • Precursor synthesis:

    • Generate the precursor protein via in vitro transcription-translation systems

    • Include radioactive amino acids (typically ³⁵S-methionine) for detection

    • Verify synthesis by SDS-PAGE and autoradiography

  • Isolated chloroplasts preparation:

    • Isolate intact chloroplasts from spinach leaves using Percoll gradient centrifugation

    • Ensure >90% intactness (verify by phase-contrast microscopy or ferricyanide reduction)

  • Import reaction:

    • Mix precursor protein with freshly isolated chloroplasts

    • Include ATP (typically 2-5 mM) as the in vitro synthesized precursor requires ATP for insertion into the envelope membrane

    • Incubate at 25°C for 20-30 minutes

  • Post-import analysis:

    • Re-isolate intact chloroplasts through Percoll cushion

    • For envelope localization verification, fractionate chloroplasts into envelope, stroma, and thylakoid fractions

    • Analyze by SDS-PAGE and fluorography

Research has shown that the spinach 37 kDa protein follows a "postimport" mechanism, where it is first imported into the chloroplast stroma and subsequently inserted into the inner envelope membrane from the stromal side .

What analytical methods are recommended for studying protein-lipid interactions of the 37 kDa protein?

For studying protein-lipid interactions of the 37 kDa inner envelope membrane protein:

  • Reconstitution into liposomes:

    • Prepare liposomes with lipid compositions mimicking the inner envelope membrane

    • Use a detergent-mediated reconstitution method followed by detergent removal

    • Verify insertion by flotation analysis and protease protection assays

  • MD simulation approaches:

    • Molecular dynamics simulations can be used to model protein-lipid interactions

    • Similar to techniques used for other chloroplast proteins (e.g., ATP synthase rotor ring)

    • Build atomistic models of the protein embedded in a lipid bilayer with appropriate composition

    • Run equilibrium simulations to analyze stable interactions with lipids

  • Chemical cross-linking:

    • Use photoactivatable lipids to identify specific lipid binding sites

    • Analyze cross-linked products by mass spectrometry

  • Biophysical analysis:

    • Circular dichroism (CD) spectroscopy to monitor secondary structure changes upon lipid binding

    • Differential scanning calorimetry (DSC) to determine the effect of protein on lipid phase transitions

    • Surface plasmon resonance (SPR) to measure binding kinetics with different lipids

  • Functional assays:

    • Enzymatic activity measurements with different lipid environments to determine optimal conditions and specific lipid requirements

What mechanisms govern the post-import targeting of the 37 kDa protein to the inner envelope membrane?

The targeting of the spinach 37 kDa inner envelope membrane protein involves a sophisticated "postimport" mechanism:

  • Initial import phase:

    • The precursor protein (pre-IE37) is synthesized in the cytosol with its N-terminal transit peptide

    • The transit peptide forms an amphiphilic α-helix with a strong hydrophobic moment

    • Pre-IE37 is imported through the Toc/Tic translocon complexes into the chloroplast stroma

    • The transit peptide is cleaved by the stromal processing peptidase (SPP), producing mature IE37

  • Stromal intermediate phase:

    • After processing, the protein exists as a soluble intermediate in the stroma

    • The protein likely interacts with stromal chaperones to maintain proper folding

  • Membrane insertion phase:

    • The mature protein is targeted to the inner envelope from the stromal side

    • Hydrophobic domains within the mature protein serve as the targeting signal

    • The C-terminal membrane-spanning segment anchors the protein in the inner envelope

    • This reexport pathway involves a specific membrane-localized translocation machinery

Research has shown that when the N-terminal extension is removed from envelope membrane proteins, they are missorted to the stroma and sometimes the thylakoid membrane, confirming that specific targeting information in the mature protein is essential for proper localization .

How does the functional state of the 37 kDa protein compare when expressed recombinantly versus in its native form?

Comparative analysis of recombinant versus native spinach 37 kDa inner envelope membrane protein:

ParameterNative ProteinRecombinant ProteinNotes
Molecular Mass37 kDa (mature)~37 kDa (plus tag if present)Recombinant proteins often include affinity tags
Functional AssemblyLikely homodimer (95-100 kDa)Can form homodimers but efficiency may varyBased on findings from similar envelope proteins
Enzymatic Activity100% (reference)70-90% of native proteinActivity may be affected by purification process
Lipid EnvironmentNatural chloroplast membrane lipidsDetergent micelles or artificial lipidsMay affect protein folding and activity
Post-translational ModificationsContains native modificationsLacks plant-specific modificationsE. coli cannot perform certain plant-specific modifications
Protein-Protein InteractionsInteracts with native envelope proteinsIsolated protein lacks interaction partnersMay affect functionality in complex biological processes

Studies on similar chloroplast envelope proteins indicate that recombinant proteins often maintain core catalytic functions but may show differences in regulatory properties due to the absence of native interactions and modifications . For optimal functionality in research applications, it's recommended to verify the activity of recombinant preparations against standards established with the native protein.

What is the role of the 37 kDa inner envelope membrane protein in the chloroplast proteome network?

The spinach 37 kDa inner envelope membrane protein (IE37) functions within a complex network of chloroplast envelope proteins:

  • Core envelope proteome participation:

    • IE37 is part of the core proteome of the chloroplast envelope membrane

    • It has been identified in proteome analyses of various plant species including Arabidopsis, pea, and spinach

    • This conservation suggests essential functions in chloroplast biology

  • Interaction with import machinery:

    • While not directly part of the Toc/Tic complexes, the protein's own import pathway utilizes this machinery

    • Its insertion may involve specialized components of the inner membrane protein insertion machinery

  • Metabolic network integration:

    • As a methyltransferase, it participates in plastoquinone and tocopherol biosynthesis pathways

    • These pathways are essential for photosynthesis and antioxidant protection

    • The protein thus links envelope membrane functions with core chloroplast metabolism

  • Evolutionary context:

    • The protein's structure and targeting mechanisms appear to represent ancestral features of chloroplast protein import

    • It shares characteristics with the core set of envelope proteins found across different plant species

  • Regulatory interactions:

    • The protein's activity may be regulated by the redox state of the chloroplast

    • It potentially interacts with other enzymes in biosynthetic pathways, forming functional metabolons

Understanding this protein's role in the chloroplast proteome network provides insights into both the evolution of protein targeting mechanisms and the functional organization of chloroplast envelope membranes.

What are common challenges in expression and purification of recombinant spinach 37 kDa protein and how can they be addressed?

ChallengeCauseSolution
Low expression levelsCodon usage bias in E. coliUse codon-optimized gene; use specialized E. coli strains (Rosetta, CodonPlus)
Inclusion body formationMembrane protein overexpressionLower induction temperature (16-20°C); reduce IPTG concentration; use solubility tags (MBP, SUMO)
Poor solubilityHydrophobic nature of membrane proteinInclude appropriate detergents (e.g., DDM, LDAO); optimize buffer conditions with glycerol or trehalose (6%)
Protein degradationProtease sensitivityAdd protease inhibitors; express in protease-deficient strains; keep samples cold
Low purityNon-specific binding to purification matrixOptimize imidazole concentration in wash buffers; consider dual affinity tags
Loss of activityImproper folding or denaturationInclude lipids during purification; avoid harsh detergents; verify secondary structure by CD spectroscopy
Aggregation during storageImproper storage conditionsStore with 5-50% glycerol; aliquot before freezing; avoid repeated freeze-thaw cycles
Inconsistent yield between batchesVariability in expression conditionsStandardize growth conditions; monitor OD600 carefully; harvest at consistent cell density

How can researchers accurately analyze the membrane topology of the 37 kDa inner envelope membrane protein?

For accurate analysis of the membrane topology of the spinach 37 kDa inner envelope membrane protein:

  • Protease protection assays:

    • Treat isolated intact chloroplasts with specific proteases (e.g., thermolysin, trypsin)

    • Thermolysin cannot penetrate the outer envelope, while trypsin can access the intermembrane space

    • Analyze protected fragments by SDS-PAGE and immunoblotting

    • Determine which domains are exposed to different compartments based on digestion patterns

  • Chemical modification approaches:

    • Use membrane-impermeable biotinylation reagents to label exposed protein domains

    • Apply reagents to intact chloroplasts versus lysed organelles

    • Compare labeled peptides to identify exposed regions

  • Fusion protein analysis:

    • Create fusion proteins with reporter tags at different positions

    • Express in chloroplasts and determine tag accessibility through protease sensitivity or fluorescence assays

    • This approach can map the orientation of different protein domains

  • Computational prediction:

    • Use hydropathy analysis to identify potential membrane-spanning segments

    • The 37 kDa protein contains one hydrophobic stretch at the C-terminus likely to span the membrane

    • Compare with topological predictions for related proteins

  • In vitro import and membrane insertion assays:

    • Create truncated versions of the protein to identify minimal regions required for membrane insertion

    • Use in vitro chloroplast import assays followed by alkaline extraction (Na₂CO₃, pH 11.5) to confirm membrane integration

    • Analyze insertion in the presence of protein transport inhibitors to identify pathway components

Understanding membrane topology is crucial for determining the protein's functional interactions and mechanism of action. Research has shown that the 37 kDa protein has a monotopic membrane association, with most of the protein embedded in one leaflet of the inner envelope membrane rather than fully spanning it .

What are the most effective methods for studying the functional activity of the 37 kDa methyltransferase in experimental settings?

To effectively study the functional methyltransferase activity of the spinach 37 kDa inner envelope membrane protein:

  • In vitro enzymatic assays:

    • Set up reactions with purified recombinant protein

    • Include substrates: 2-methyl-6-phytyl-1,4-hydroquinone and S-adenosylmethionine (SAM)

    • Monitor product formation using HPLC or LC-MS

    • Quantify activity under different conditions (pH, temperature, cofactors)

  • Reaction optimization parameters:

    • Temperature range: 25-30°C (optimal for chloroplast enzymes)

    • pH range: 7.5-8.5 (chloroplast stroma pH)

    • Include Mg²⁺ (1-5 mM) as potential cofactor

    • Test sensitivity to reducing agents (DTT) and chelators (EDTA)

  • Enzyme kinetics analysis:

    • Determine Km values for both substrates

    • Calculate Vmax and catalytic efficiency (kcat/Km)

    • Analyze potential regulation by product inhibition

    • Assess cooperativity if the enzyme functions as a dimer

  • Activity reconstitution in membrane models:

    • Reconstitute protein in liposomes with defined lipid composition

    • Compare activity in different membrane environments to determine lipid requirements

    • Test activity in nanodiscs for a more native-like membrane environment

  • Inhibitor studies:

    • Test potential inhibitors to characterize active site

    • Use S-adenosylhomocysteine (SAH) as competitive inhibitor

    • Determine IC50 values for structure-activity relationship studies

  • Coupled enzyme assays:

    • Develop coupled assays to monitor SAM-dependent methyltransferase activity

    • Link to SAH nucleosidase and adenine deaminase to allow continuous spectrophotometric monitoring

These methodologies enable comprehensive characterization of the enzymatic function and regulatory properties of the 37 kDa inner envelope membrane protein, providing insights into its role in plastoquinone and tocopherol biosynthesis in chloroplasts.

What emerging technologies might advance our understanding of the structure-function relationship of the spinach 37 kDa inner envelope membrane protein?

Several emerging technologies show promise for advancing our understanding of this important chloroplast protein:

  • Cryo-electron microscopy:

    • Single-particle cryo-EM could reveal the high-resolution structure of the purified protein

    • The ex vivo approach demonstrated with other spinach chloroplast proteins could be applied

    • This would provide detailed insights into the active site architecture and membrane association

  • Integrative structural biology approaches:

    • Combining X-ray crystallography, cryo-EM, and NMR spectroscopy

    • Complementing with molecular dynamics simulations

    • Cross-linking mass spectrometry to map protein-protein interactions

  • Native mass spectrometry:

    • Analyze the intact protein complex with bound ligands

    • Determine oligomeric state and stoichiometry

    • Study protein-lipid interactions under near-native conditions

  • In situ structural biology:

    • Cryo-electron tomography of chloroplast membranes

    • Correlative light and electron microscopy (CLEM)

    • Visual proteomics approaches to locate proteins within membranes

  • Advanced genetic approaches:

    • CRISPR-Cas9 genome editing in chloroplast model systems

    • Site-specific incorporation of unnatural amino acids for biophysical studies

    • Optogenetic control of protein activity to study real-time function

These technologies would help resolve outstanding questions about the protein's mechanism of action, membrane integration, and interactions with other components of the chloroplast envelope system.

How might the spinach 37 kDa inner envelope membrane protein be utilized in synthetic biology applications?

The spinach 37 kDa inner envelope membrane protein offers several opportunities for synthetic biology applications:

  • Engineered chloroplast membrane systems:

    • Design of minimal artificial organelles with defined membrane protein composition

    • Engineering chloroplast envelope permeability by modifying protein structure

    • Creation of hybrid membrane systems with both natural and synthetic components

  • Metabolic engineering platforms:

    • Enhancement of vitamin E production through optimized methyltransferase activity

    • Redirection of isoprenoid biosynthesis pathways in chloroplasts

    • Engineering of microalgae or cyanobacteria for renewable chemical production

  • Protein targeting applications:

    • Use of the protein's transit peptide and targeting information to direct novel proteins to chloroplast envelopes

    • Development of chimeric proteins with novel functionalities localized to the chloroplast inner envelope

    • Creation of sensing systems anchored in chloroplast membranes

  • Bionanotechnology:

    • Development of membrane protein-based nanoscale devices

    • Creation of responsive biomolecular systems using the protein's natural structural elements

    • Design of protein-lipid hybrid materials with specific recognition capabilities

These applications could provide new tools for both fundamental research and biotechnological development in areas ranging from bioenergy production to synthetic organelle engineering.

What are the critical knowledge gaps that need to be addressed regarding the spinach 37 kDa inner envelope membrane protein?

Despite decades of research, several critical knowledge gaps remain:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.