Recombinant Spinacia oleracea Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Spinacia oleracea Apocytochrome f (petA)

Spinacia oleracea Apocytochrome f (petA), commonly known as spinach apocytochrome f, is a protein component integral to the cytochrome b6f complex found in the thylakoid membranes of chloroplasts in spinach and other plants . As a pivotal element in photosynthetic electron transfer, cytochrome f facilitates the movement of electrons between Photosystem II and Photosystem I .

Recombinant Spinacia oleracea Apocytochrome f (petA) refers to the protein produced through recombinant DNA technology, wherein the gene encoding spinach apocytochrome f (petA) is expressed in a host organism, such as E. coli . This approach enables the production of the protein in large quantities for research and industrial applications .

Production and Purification of Recombinant Protein

  • Expression in E. coli A fragment of the petA gene from broad bean, corresponding to the N-terminal domain of the mature protein, can be expressed in E. coli . An ATG start codon is incorporated into the truncated petA gene using an upstream primer. The amplified PCR product is digested with restriction enzymes such as NcoI/HindIII and then cloned into an expression vector like pTrc99A .

  • Purification Methods Cell lysate containing the recombinant cytochrome f protein is isolated and purified using chromatographic techniques, such as size-exclusion column chromatography, to ensure the removal of contaminants and the isolation of the target protein .

Research Findings and Applications

  • Interaction with CCS5 Studies indicate that CCS5, a thioredoxin-like protein, interacts with apocytochrome f and is involved in the assembly of plastid cytochrome complexes. CCS5 exhibits disulfide reductase activity and can reduce disulfide bonds in apocytochrome f, suggesting its role in facilitating heme attachment .

  • Bolting Time in Spinach Research has identified quantitative trait loci (QTLs) associated with bolting time in spinach, with candidate genes such as SpFLC and SpCOL14 being implicated in controlling this trait .

  • ELISA Applications Recombinant Spinacia oleracea Apocytochrome f (petA) is utilized in enzyme-linked immunosorbent assays (ELISA) for various research purposes, including protein quantification and detection .

Table 1: QTLs Associated with Bolting Time in Spinach

QTLChromosomePosition (Mb)LOD ScorePVE (%)
qBT1.1147.72–50.6116.3949.07
qBT1.2141.44–42.023.468.90
qBT1.1146.76–49.1213.3940.86

Table 2: Fatty Acid Composition of Total Lipid Extracts from Thylakoids

Lipid ComponentThylakoids
Fatty Acid XValue 1
Fatty Acid YValue 2

Note: Actual values for fatty acid composition were not available in the provided documents and should be obtained from the original study.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Spinacia oleracea (Spinach)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQV LANGKKGGLNVGAVLILPEGFELAPPDRISPEMKEKMGNLSFQSYRPNKQNILVIGPVPG QKYSEITFPILAPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNSTATGIVK KIVRKEKGGYEINIADASDGREVVDIIPRGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEVVLQDPLRIQGLLFFFASVILAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Database Links

KEGG: soe:2715597

Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

How is the petA gene organized in the chloroplast genome of different species?

The organization of the petA gene varies significantly between different evolutionary lineages:

In Chlamydomonas reinhardtii, the petA gene is part of a transcription unit with the downstream petD gene. Interestingly, although monocistronic transcripts for both genes accumulate in wild-type cells, deletion of the petD promoter still allows accumulation of wild-type levels of monocistronic petD mRNA, suggesting co-transcription from the upstream petA promoter followed by efficient 5' processing .

In contrast, in rhodophyte alga Porphyra purpurea and cryptophyte alga Guillardia theta, the petA gene homolog (ycf6) is organized in an operon with petM, which encodes another subunit of the cytochrome b6f complex. This arrangement indicates tightly coordinated expression of these components .

In higher plants like spinach, petA is not directly linked to other photosynthesis genes in the chloroplast genome, and petM has been transferred to the nuclear genome, suggesting the evolution of different regulatory mechanisms .

What expression systems are most effective for recombinant Spinacia oleracea Apocytochrome f production?

E. coli is the most well-established system for expressing recombinant Apocytochrome f from Spinacia oleracea. When designing expression constructs, researchers should consider:

  • Using a truncated version lacking the transmembrane domain if studying the soluble N-terminal domain is sufficient for experimental purposes

  • Including an N-terminal His-tag for simplified purification

  • Employing vectors with strong promoters such as pTrc99A, which has been successfully used for cytochrome f fragment expression

For expression, induction with 1 mM isopropyl-1-thio-β-d-galactopyranoside (IPTG) at 30°C for 3 hours has been shown to be effective when cells reach A600 = 0.6 . This approach provides good yield while balancing protein solubility and avoiding inclusion body formation.

What are the optimal storage and reconstitution conditions for recombinant Apocytochrome f?

Recombinant Apocytochrome f is typically supplied as a lyophilized powder that requires careful handling to maintain activity. Researchers should follow these guidelines:

Storage:

  • Store lyophilized protein at -20°C to -80°C upon receipt

  • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for long-term storage (50% is typically recommended)

  • Aliquot for long-term storage at -20°C/-80°C

The reconstituted protein is typically stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain stability during freeze-thaw cycles .

How can truncated versions of Apocytochrome f be used to study protein function and membrane association?

Truncated versions of cytochrome f provide valuable tools for studying specific domains and their functions:

A recombinant fragment of cytochrome f lacking the 35 C-terminal residues (which include the stromal domain and transmembrane α-helix) has been used to study the function of the large hydrophilic N-terminal domain . When comparing this truncated version (250 amino acids) with the native protein and cytochrome f catabolites by SDS-PAGE, researchers discovered that cytochrome f catabolites must retain portions of the transmembrane α-helix, as they are larger than the truncated version despite missing parts of both the N and C termini .

This approach can be utilized to:

  • Determine the minimal functional domain requirements

  • Study membrane association mechanisms

  • Investigate protein-protein interactions of specific domains

  • Examine the role of the transmembrane domain in complex assembly

Research has shown that cytochrome f catabolites containing the transmembrane α-helix remain associated with thylakoid membranes and stromal lipid-protein particles, demonstrating the importance of this domain for membrane anchoring .

What molecular mechanisms govern cytochrome b6f complex assembly, and how does cytochrome f contribute?

The assembly of the cytochrome b6f complex is a coordinated process involving multiple subunits, with cytochrome f playing a crucial role:

  • Cytochrome f is essential for both electron transfer and complex assembly

  • When cytochrome f is not synthesized or not properly targeted to the thylakoid membrane, all other subunits of the complex become highly unstable and are rapidly degraded

  • The transmembrane α-helix of cytochrome f is critical for anchoring the protein in the thylakoid membrane

Studies with the Ycf6/PetN protein (encoded by the ycf6 gene) have shown that this small hydrophobic polypeptide of just 29 amino acids is also essential for cytochrome b6f complex assembly and/or stability. Knockout of this gene leads to complete loss of functional cytochrome b6f complex and consequently, loss of all photosynthetic activity .

The assembly process appears to involve:

  • Coordinated expression of component genes

  • Proper membrane targeting of the components

  • Stabilization through protein-protein interactions

  • Integration of cofactors such as heme groups

How does the transcription of petA differ between algae and higher plants?

Transcriptional patterns of the petA gene show notable differences between algae and higher plants:

In vascular plants, most chloroplast genes are organized into polycistronic transcription units, generating complex patterns of mono-, di-, and polycistronic transcripts. For example, the psbB gene cluster in spinach and maize generates approximately 20 RNA species through processing of a primary transcript containing five coding regions .

These differences reflect distinct evolutionary adaptations in chloroplast gene expression regulation:

  • Higher plants tend toward complex polycistronic operons with extensive processing

  • Algae show more individual gene expression with limited co-transcription events

  • The degree of co-transcription in algae like C. reinhardtii may be underestimated, as revealed by promoter deletion studies

What roles do thioredoxin-like proteins play in cytochrome f assembly?

Thioredoxin-like proteins have been implicated in the assembly of cytochrome complexes through redox regulation:

Research on CCS5, a thioredoxin-like protein, has shown its involvement in the assembly of plastid c-type cytochromes. This involvement is supported by several findings:

  • The ccs5 mutant is rescued by exogenous thiols

  • CCS5 interacts with apocytochrome f and c6 in a yeast two-hybrid system

Thioredoxins likely function by:

  • Maintaining proper redox conditions for cytochrome assembly

  • Facilitating disulfide bond formation or rearrangement

  • Interacting directly with apocytochrome f during its maturation

  • Contributing to cofactor (heme) attachment

This suggests that proper assembly of cytochrome f into functional complexes requires not only the presence of all structural components but also appropriate redox conditions and protein-folding assistance.

What analytical methods can be used to verify the integrity and functionality of recombinant Apocytochrome f?

Multiple analytical techniques can assess the quality of recombinant Apocytochrome f:

Protein Integrity:

  • SDS-PAGE: Confirms proper molecular weight and purity (>90% purity is typically achieved)

  • Western blotting: Verifies identity using anti-cytochrome f antibodies

  • Mass spectrometry: Provides precise molecular weight and can detect modifications

Functional Analysis:

  • Spectroscopic methods: UV-visible spectroscopy can detect characteristic absorption peaks of properly folded cytochrome f with integrated heme

  • Redox activity assays: Measure electron transfer capacity

  • Reconstitution experiments: Test ability to incorporate into membrane systems

Structural Verification:

  • Circular dichroism: Provides information about secondary structure elements

  • Limited proteolysis: Can indicate proper folding through resistance to digestion

  • Protein-protein interaction assays: Verify ability to interact with known partners

When interpreting data from these methods, researchers should compare results with those from native cytochrome f to assess functional equivalence of the recombinant protein.

How can researchers troubleshoot issues with recombinant Apocytochrome f stability and solubility?

Common stability and solubility issues with recombinant Apocytochrome f can be addressed through several approaches:

Stability Issues:

  • Add protease inhibitors during purification and storage

  • Optimize buffer conditions (pH 8.0 is typically effective)

  • Include stabilizing agents such as trehalose (6%) in storage buffers

  • Use glycerol (5-50%) for long-term storage

  • Aliquot and avoid repeated freeze-thaw cycles

Solubility Issues:

  • Express truncated versions lacking the transmembrane domain for higher solubility

  • Use detergents for full-length protein (such as those used in cytochrome b6f complex purification protocols)

  • Adjust ionic strength of buffers

  • Consider fusion tags that enhance solubility (in addition to purification tags)

  • Lower induction temperature during expression (30°C has been shown to be effective)

Expression Troubleshooting:

  • Verify codon optimization for E. coli

  • Test different E. coli strains specialized for membrane protein expression

  • Adjust induction conditions (IPTG concentration, temperature, duration)

  • Consider specialized media formulations

Data from experimental troubleshooting should be carefully documented to establish optimal conditions for each specific research application.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.