Recombinant Spinacia oleracea ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Overview and Nomenclature

Recombinant Spinacia oleracea ATP synthase subunit a, chloroplastic (atpI) refers to a recombinant protein representing the a subunit of the chloroplast ATP synthase from spinach (Spinacia oleracea). This subunit is a critical component of the F₀ sector of the F₀F₁ ATP synthase complex, which catalyzes ATP synthesis during photosynthesis. The recombinant form is engineered for structural, functional, and biochemical studies, enabling precise investigations into proton translocation and ATP synthase assembly .

Key identifiers:

ParameterValue
Gene NameatpI
UniProt IDP06451
Subunit RoleF₀ sector (proton channel and translocation)
Host OrganismEscherichia coli
TagN-terminal His-tag
Full-Length Sequence247 amino acids (1-247aa)

Recombinant Production and Purification

The recombinant a subunit is produced in E. coli using optimized protocols to ensure solubility and functionality.

Production Workflow:

  1. Expression: Codon-optimized atpI gene cloned into expression vectors (e.g., pET plasmids) and expressed in E. coli strains like BL21(DE3) .

  2. Purification:

    • Affinity Chromatography: N-terminal His-tag enables purification via nickel-nitrilotriacetic acid (Ni-NTA) columns.

    • Quality Control: SDS-PAGE confirms >85% purity, with molecular weight ~28 kDa (calculated for 247aa) .

Functional Parameters of Spinach ATP Synthase

ParameterValue
ATP Synthesis Rate (E. coli)0.20 μmol/min/mg membrane protein (37°C)
Maximal Velocity (E. coli)~350 revolutions/sec (37°C)
Torque Generation40 piconewtons·nm (γ subunit rotation)

Data sourced from .

Limitations and Challenges

  • Low Yield: Hydrophobic nature of membrane proteins complicates solubility and purification .

  • Functional Validation: Recombinant a subunit requires reconstitution with other subunits (b, c) to assess full activity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Spinacia oleracea (Spinach)
Target Names
atpI
Target Protein Sequence
MNVLSYSINPLKGLYAISGVEVGQHFYWQIGGFQIHGQVLITSWVVIAILLGSAAIAVRS PQTIPTGGQNFFEYVLEFIRDVSKTQIGEEYRPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESLEGHH
Uniprot No.

Target Background

Function

Key component of the proton channel; it plays a crucial role in proton translocation across the membrane.

Database Links

KEGG: soe:2715580

Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of chloroplast ATP synthase in which atpI operates?

Chloroplast ATP synthase (CFoCF1) is a molecular motor that converts energy from a membrane electrochemical potential into high-energy phosphate bonds in ATP molecules. This enzyme complex consists of two major parts: the membrane-embedded Fo portion (containing subunit a/atpI) and the soluble catalytic F1 portion. The complex functions through a chemiosmotic mechanism, where proton (H+) diffusion across the thylakoid membrane is coupled to ATP synthesis .

How does recombinant expression of atpI differ from other ATP synthase subunits?

Recombinant expression of atpI presents unique challenges compared to other ATP synthase subunits due to:

  • Membrane integration complexity: As a highly hydrophobic membrane protein with multiple transmembrane helices, atpI requires specialized expression systems that facilitate proper membrane insertion and folding.

  • Toxicity issues: Overexpression often leads to cellular toxicity as the protein can disrupt host membrane integrity when accumulated at high levels.

  • Co-expression requirements: Functional studies typically require co-expression with other Fo subunits to form a stable complex capable of proton translocation.

  • Purification challenges: The protein requires detergent solubilization and specialized chromatography techniques that maintain structural integrity while removing membrane lipids.

Methodologically, successful expression typically involves E. coli-based systems with regulated expression promoters, specialized membrane-protein-friendly E. coli strains, and fusion tags that enhance solubility without compromising function.

What experimental evidence confirms the function of atpI in proton translocation?

Experimental confirmation of atpI's role in proton translocation comes from multiple approaches:

  • Reconstitution studies: Purified atpI reconstituted into liposomes allows measurement of passive proton conductance.

  • Acid-base transition assays: Similar to experiments with complete chloroplast ATP synthase, these assays demonstrate that proton translocation through atpI-containing complexes can drive ATP synthesis when a proton gradient is artificially imposed .

  • Site-directed mutagenesis: Modification of conserved residues in atpI alters proton translocation efficiency, confirming their functional importance.

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry identifies specific interactions between atpI and other subunits involved in the proton translocation pathway.

Experimental ApproachKey MeasurementsTechnical Challenges
Liposome reconstitutionProton flux rate, membrane potentialAchieving correct orientation in liposomes
Acid-base transitionATP synthesis upon pH shiftMaintaining protein stability during pH changes
Site-directed mutagenesisComparative proton flux ratesEnsuring mutations don't affect protein stability
Cross-linkingSubunit interaction mapsDistinguishing specific from non-specific interactions

What are the optimal expression systems for recombinant Spinacia oleracea atpI?

Several expression systems have been evaluated for recombinant production of spinach atpI, each with advantages and limitations:

For the highest functional yields, co-expression with other subunits of the Fo complex significantly enhances stability and proper folding of atpI.

What purification strategies maximize yield and activity of recombinant atpI?

Purification of functional recombinant atpI requires careful consideration of detergents, buffer conditions, and chromatography techniques:

  • Membrane extraction:

    • Mild detergents (DDM, LMNG) at concentrations just above CMC maintain native structure.

    • Lipid supplementation (spinach thylakoid lipids) during solubilization preserves activity.

  • Affinity chromatography:

    • His-tag purification with imidazole gradients reduces non-specific binding.

    • On-column detergent exchange optimizes downstream applications.

  • Size exclusion chromatography:

    • Critical for removing aggregates and selecting properly folded protein.

    • Buffer optimization (including glycerol, reducing agents) maintains stability.

  • Reconstitution:

    • Controlled detergent removal via dialysis or Bio-Beads produces proteoliposomes.

    • Lipid composition significantly affects functional reconstitution efficiency.

Purification StepCritical ParametersQuality Control Metrics
Membrane solubilizationDetergent:protein ratio, temperatureSolubilization efficiency
Affinity chromatographyFlow rate, imidazole concentrationPurity by SDS-PAGE
Size exclusionBuffer composition, protein concentrationMonodispersity by DLS
ReconstitutionLipid:protein ratio, detergent removal rateProton translocation activity

How can we assess the structural integrity of purified recombinant atpI?

Assessment of structural integrity requires a combination of biophysical techniques:

  • Circular dichroism (CD) spectroscopy:

    • Secondary structure analysis confirms proper folding.

    • Thermal stability measurements identify optimal buffer conditions.

  • Tryptophan fluorescence:

    • Intrinsic fluorescence monitors tertiary structure integrity.

    • Quenching studies provide information on solvent accessibility.

  • Limited proteolysis:

    • Time-course digestion patterns distinguish between properly folded and misfolded states.

    • Mass spectrometry identifies protected regions within the proper structure.

  • Analytical ultracentrifugation:

    • Sedimentation velocity experiments confirm homogeneity and oligomeric state.

    • Assessment of detergent binding and protein-detergent complex properties.

These techniques provide complementary information on different aspects of structural integrity, ensuring that the recombinant protein maintains native-like properties throughout purification and subsequent studies.

How does recombinant atpI interact with the redox regulatory mechanism of chloroplast ATP synthase?

  • Structural coupling mechanism:

    • Cryo-EM studies of spinach chloroplast ATP synthase show that the oxidized γ subunit introduces a torsional constraint via its disulfide linkage, which stabilizes two β hairpin structures .

    • This constraint affects the entire complex, including the proton-conducting path involving atpI.

    • Upon reduction, this constraint is alleviated, enabling a concerted motion of the enzyme complex and facilitating smooth transition between rotary states for ATP synthesis .

  • Experimental approaches to study atpI involvement:

    • Cross-linking analysis between atpI and other subunits under different redox conditions reveals changes in proximity.

    • Hydrogen-deuterium exchange mass spectrometry identifies regions of atpI with altered solvent accessibility between redox states.

    • Site-directed spin labeling coupled with EPR spectroscopy detects conformational changes in atpI during redox transitions.

  • Functional consequences:

    • Proton conductance through atpI-containing channels is modulated indirectly by the redox state of the γ subunit.

    • The rotation of the c-ring relative to atpI is affected by the redox-dependent constraint, altering proton translocation efficiency.

This regulation is critical for preventing wasteful ATP hydrolysis during darkness when photosynthetic membranes are de-energized .

What advanced structural analysis techniques are most effective for studying recombinant atpI?

Given the challenges of membrane protein structure determination, several advanced techniques offer valuable insights into atpI structure:

  • Cryo-electron microscopy:

    • Single-particle analysis of detergent-solubilized complexes can achieve near-atomic resolution.

    • The addition of inhibitors like tentoxin can limit flexibility and improve resolution .

    • Recent advances in cryo-EM have enabled determination of structures in both reduced and oxidized states of chloroplast ATP synthase .

  • Solid-state NMR spectroscopy:

    • Provides atomic-level information about specific residues without crystallization.

    • Requires isotopic labeling of recombinant atpI (15N, 13C).

    • Particularly valuable for studying dynamics of transmembrane helices.

  • X-ray free-electron laser (XFEL) crystallography:

    • Microcrystals of membrane proteins can be analyzed with minimal radiation damage.

    • Time-resolved studies can capture different conformational states during function.

  • Integrative modeling approaches:

    • Combines data from multiple experimental sources (cross-linking MS, cryo-EM, SAXS).

    • Molecular dynamics simulations in explicit membrane environments provide dynamic information.

TechniqueResolution RangeKey AdvantagesPrimary Limitations
Cryo-EM2.5-4 ÅNo crystals required, captures conformational statesLower resolution for smaller proteins
Solid-state NMRAtomicSite-specific information, dynamicsRequires large amounts of labeled protein
XFEL1.5-3 ÅMinimal radiation damage, time-resolvedRequires microcrystals, limited beam time
Integrative modelingVariableCombines multiple data sourcesAccuracy depends on quality of constraints

What mutations in atpI would provide insights into the proton translocation mechanism?

Strategic mutagenesis can elucidate the specific residues involved in proton translocation:

  • Conserved charged residues:

    • Mutagenesis of conserved Arg, Glu, and Asp residues that likely form the proton path.

    • Charge neutralization (E→Q, D→N) versus charge reversal (E→K, R→E) provides different functional information.

    • Double mutant cycles identify coupled residues within the proton pathway.

  • Transmembrane helix interface residues:

    • Mutations at predicted interfaces between atpI and the c-ring affect rotational coupling.

    • Cysteine substitutions followed by cross-linking can trap specific rotational states.

  • Proton-sensing residues:

    • His substitutions introduce pH-dependent behavior at specific positions.

    • Unnatural amino acid incorporation (e.g., fluorinated derivatives) allows fine-tuning of pKa values.

  • Conformational switch residues:

    • Glycine or proline substitutions alter helix flexibility at potential "hinge" regions.

    • Site-directed spin labeling at these positions can detect conformational changes during catalysis.

Each mutation can be assessed using the acid-base transition method established for chloroplast ATP synthase, which couples proton gradient formation to ATP synthesis activity measurements .

Mutation TypeExample PositionsFunctional Impact AssessmentExpected Outcome
Charged residuesConserved Arg, Glu, AspProton translocation rate, ATP synthesisIdentify essential proton path components
Interface residuesResidues facing c-ringCross-linking efficiency, rotation couplingDetermine interaction surfaces and dynamics
pH sensorsNon-conserved polar residuespH dependence of activityIdentify regulatory pH-sensing sites
Conformational switchesGly-rich regionsEPR mobility, activity couplingMap regions involved in conformational changes

How can advanced biochemical techniques be applied to study the integration of recombinant atpI into functional ATP synthase complexes?

Several sophisticated approaches can assess the correct assembly and function of recombinant atpI:

  • Native mass spectrometry:

    • Determines subunit stoichiometry and complex integrity.

    • Allows detection of subcomplexes formed during assembly.

    • Recent advances enable analysis of intact membrane protein complexes.

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) between labeled subunits monitors assembly.

    • Optical tweezers measurements capture rotational steps during ATP synthesis.

    • Magnetic tweezers experiments can apply controlled torque to study mechanistic aspects.

  • Chemical biology approaches:

    • Unnatural amino acid incorporation at specific sites introduces bioorthogonal handles.

    • Click chemistry-based proximity labeling identifies transient interaction partners.

    • Photocrosslinking captures dynamic interactions during the catalytic cycle.

  • In vitro reconstitution systems:

    • Acid-base transition methods employed in chloroplast studies can be adapted for recombinant systems .

    • Reconstitution into liposomes with co-purified or separately purified subunits.

    • Activity can be assessed through ATP synthesis measurements when proton gradients are artificially imposed .

These techniques go beyond traditional biochemical approaches to provide dynamic and mechanistic insights into how atpI functions within the complete ATP synthase complex.

How can recombinant atpI be used to study evolutionary adaptation of chloroplast ATP synthase?

Recombinant atpI provides a powerful tool for comparative evolutionary studies:

  • Complementation systems:

    • Expression of spinach atpI in cyanobacterial or algal mutants lacking endogenous atpI.

    • Functional assessment across phylogenetically diverse backgrounds.

    • Chimeric proteins containing domains from different species identify adaptation-critical regions.

  • Ancestral sequence reconstruction:

    • Computational inference and experimental production of ancestral atpI sequences.

    • Functional characterization reveals evolutionary trajectories of proton translocation mechanisms.

    • Site-directed mutagenesis to revert modern adaptations to ancestral states.

  • Comparative biochemistry:

    • Side-by-side characterization of atpI from diverse photosynthetic organisms (cyanobacteria, algae, higher plants).

    • Correlation of biochemical properties with environmental adaptation.

    • Analysis of temperature, pH, and salt tolerance as factors driving evolutionary divergence.

This research direction provides insights into how chloroplast ATP synthase has evolved specialized regulatory mechanisms, such as the redox regulation observed in the γ subunit , and how these adaptations influence the entire complex including atpI.

What role does atpI play in the redox regulation mechanism that distinguishes chloroplast ATP synthase?

While the redox-sensitive cysteines are located on the γ subunit rather than atpI, understanding the conformational coupling between these components is crucial:

This research area is particularly important as it addresses how plants have evolved specialized energy conservation mechanisms that prevent wasteful ATP hydrolysis during darkness .

Redox StateStructural FeaturesFunctional ConsequenceExperimental Approach
Oxidized (disulfide)Torsional constraint on γ subunit, stabilized β hairpins Limited conformational flexibility, inhibited ATP synthesisCryo-EM, HDX-MS, activity assays
Reduced (free thiols)Alleviated constraint, concerted motion Smooth transition between rotary states, active ATP synthesisSingle-molecule FRET, rotation assays

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.