Recombinant Spinacia oleracea Chlorophyll a-b binding protein, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. Please specify your tag type requirement for preferential development.
Synonyms
Chlorophyll a-b binding protein, chloroplastic; LHCII type I CAB; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-267
Protein Length
Full Length of Mature Protein
Species
Spinacia oleracea (Spinach)
Target Protein Sequence
RKTAGKPKTVQSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAK NRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVH AQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKE IKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWNFATNFVPGK
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the Chlorophyll a-b binding protein gene in spinach?

The spinach genome has been sequenced and assembled, with a draft genome size of approximately 870 Mb and N50 scaffold length of ~319.5 kb . The genome contains 25,495 protein-coding genes, and is highly repetitive with 74.4% of its content consisting of transposable elements . The genomic context of the Chlorophyll a-b binding protein can be understood through protein-coding gene prediction methods that were performed using MAKER, which combines evidence from ab initio, transcript mapping, and protein homology-based predictions .

The genes encoding chlorophyll-binding proteins can be found by examining the spinach genome assembly, which has been anchored to six linkage groups covering 463.4 Mb (47%) of the assembled genome . Researchers investigating the genomic context should utilize the available genome data to understand regulatory elements and potential gene duplications.

How does the structure of spinach Chlorophyll a-b binding protein compare to those from other species?

While the search results don't provide direct structural comparisons of spinach Chlorophyll a-b binding protein with those from other species, we can infer some insights based on the protein sequence. The protein contains characteristic domains typical of chlorophyll-binding proteins, including transmembrane domains and chlorophyll-binding motifs .

For experimental structure determination, methods such as X-ray crystallography have been successfully applied to other spinach proteins. For instance, recombinant PsbP protein from S. oleracea was purified and crystallized without partial degradation . Similar approaches could be applied to the chlorophyll a-b binding protein, though membrane proteins often present additional challenges requiring specialized techniques such as detergent solubilization or lipid cubic phase crystallization.

What are the optimal conditions for expressing recombinant Spinacia oleracea Chlorophyll a-b binding protein?

Based on successful techniques used for other spinach proteins, the following methodology is recommended:

  • Expression System Selection: For recombinant expression, an E. coli system with a T7 promoter-based vector is commonly used. Alternative systems include yeast or insect cell expression systems for proteins requiring eukaryotic post-translational modifications.

  • Optimization of Expression Conditions: Test various temperatures (16-37°C), induction times (2-24 hours), and IPTG concentrations (0.1-1.0 mM) to determine optimal expression conditions.

  • Construct Design: Include a purification tag (e.g., His-tag) at the N-terminus, with a protease cleavage site for tag removal. For the spinach Chlorophyll a-b binding protein, similar to other spinach proteins, an N-terminal six-His tag construct has been successfully employed .

  • Buffer Optimization: Test protein stability in various buffers. For example, recombinant spinach proteins have shown highest stability in 20 mM potassium phosphate buffer at different pH values .

What purification strategies yield the highest purity and activity for recombinant Chlorophyll a-b binding protein?

A multi-step purification strategy is recommended:

  • Metal-Affinity Chromatography: If using a His-tagged construct, purify using Ni-NTA or similar affinity resin. For spinach proteins, this approach has been successful as the initial purification step .

  • Ion-Exchange Chromatography: Follow affinity purification with ion-exchange chromatography to separate proteins based on charge differences .

  • Size-Exclusion Chromatography: Add this as a final step to separate the target protein from proteases, cleaved tags, and any remaining contaminants. This has been critical for obtaining homogeneous preparations of spinach proteins .

  • Stability Enhancement: Throughout purification, maintain appropriate buffer conditions. For spinach proteins, 20 mM potassium phosphate buffer has shown good results for maintaining stability .

  • Activity Verification: After purification, confirm protein activity through functional assays such as chlorophyll-binding assays or spectroscopic analysis of pigment binding.

How can researchers effectively reconstitute chlorophyll binding to the recombinant protein?

Effective reconstitution of chlorophyll binding requires:

  • Pigment Preparation: Extract chlorophyll a and b from spinach leaves using organic solvents (acetone/methanol), followed by HPLC purification to separate chlorophyll a from b.

  • Protein Preparation: Ensure the recombinant protein is properly folded, typically requiring gentle detergent solubilization.

  • Reconstitution Protocol:

    • Mix purified protein with chlorophyll in appropriate molar ratios

    • Provide a lipid environment (e.g., liposomes or nanodiscs)

    • Remove detergent gradually using dialysis or adsorption methods

    • Monitor binding spectroscopically through absorbance and fluorescence measurements

  • Verification of Binding: Use analytical techniques such as size-exclusion chromatography, native PAGE, or analytical ultracentrifugation to confirm stable complex formation.

What experimental approaches are most suitable for determining the structure of spinach Chlorophyll a-b binding protein?

Several complementary approaches are recommended:

How can researchers investigate the interaction between the Chlorophyll a-b binding protein and other components of the photosynthetic apparatus?

The following methodological approaches are recommended:

  • Co-Immunoprecipitation: Using antibodies against the chlorophyll a-b binding protein to pull down interacting partners.

  • Yeast Two-Hybrid or Split-GFP Assays: For identifying protein-protein interactions.

  • Surface Plasmon Resonance or Isothermal Titration Calorimetry: For quantifying binding affinities and thermodynamics.

  • Crosslinking Mass Spectrometry: To identify interaction interfaces at the amino acid level.

  • In vivo FRET or FLIM: To study interactions in living plant cells.

  • Reconstituted Proteoliposomes: For functional studies of protein complexes in a membrane environment.

How do genetic variations in the Chlorophyll a-b binding protein gene correlate with photosynthetic efficiency in different spinach varieties?

This question requires a multifaceted approach:

  • Genomic Analysis: Sequence the Chlorophyll a-b binding protein gene from diverse spinach varieties. The spinach genome sequencing approach described in the literature provides a foundation for such analyses, where comprehensive genome sequencing and assembly methodologies have been established .

  • Transcriptomic Profiling: Use RNA-Seq to measure expression levels across varieties and conditions. Existing transcriptome sequencing of 120 spinach accessions has revealed more than 420K variants that could be analyzed for correlations with photosynthetic traits .

  • Protein Analysis: Quantify protein abundance and post-translational modifications using proteomics.

  • Photosynthetic Measurements: Correlate genetic variations with photosynthetic parameters such as quantum yield, electron transport rate, and non-photochemical quenching.

  • Statistical Analysis: Use methods like genome-wide association studies (GWAS) to identify statistically significant associations between genetic variants and phenotypic traits.

What are the molecular mechanisms of light-harvesting regulation mediated by the spinach Chlorophyll a-b binding protein under varying environmental conditions?

This complex question requires integrating multiple experimental approaches:

  • Time-Resolved Spectroscopy: Measure energy transfer kinetics under different light conditions.

  • Site-Directed Mutagenesis: Identify key residues involved in regulation by creating point mutations and measuring their effects on function.

  • Phosphorylation Analysis: Investigate how phosphorylation status changes under different light conditions and how this affects protein function.

  • Protein-Protein Interaction Studies: Examine how interactions with regulatory proteins change under different conditions.

  • Structural Studies: Compare protein conformations under different environmental conditions using techniques such as hydrogen-deuterium exchange mass spectrometry.

  • Computational Modeling: Simulate energy transfer and regulatory mechanisms based on experimental data.

How can CRISPR-Cas9 gene editing be optimized for studying the function of Chlorophyll a-b binding protein in Spinacia oleracea?

Optimizing CRISPR-Cas9 for spinach requires:

  • Guide RNA Design: Design sgRNAs targeting the Chlorophyll a-b binding protein gene with high specificity using the spinach genome sequence . Multiple algorithms are available to predict off-target effects.

  • Delivery Methods: Develop effective protocols for delivering CRISPR-Cas9 components into spinach cells, such as:

    • Agrobacterium-mediated transformation

    • Biolistic bombardment of callus tissue

    • Protoplast transformation followed by regeneration

  • Screening Strategy: Develop efficient methods to identify and verify edited plants:

    • PCR-based genotyping

    • T7 endonuclease assay

    • Sanger sequencing

    • Next-generation sequencing for comprehensive off-target analysis

  • Phenotypic Analysis: Employ advanced phenotyping technologies to assess the effects of gene editing on:

    • Photosynthetic efficiency using chlorophyll fluorescence imaging

    • Plant growth and development under various light conditions

    • Stress responses and adaptation mechanisms

  • Complementation Studies: Introduce modified versions of the gene to verify function and study structure-function relationships.

How has the Chlorophyll a-b binding protein evolved across plant species, and what can this tell us about photosynthetic adaptation?

This evolutionary analysis requires:

  • Phylogenetic Analysis: Construct phylogenetic trees using Chlorophyll a-b binding protein sequences from diverse plant species, including spinach. The spinach genome data provides a foundation for such comparative analyses .

  • Selection Pressure Analysis: Calculate dN/dS ratios to identify sites under positive or purifying selection.

  • Structural Comparison: Compare protein structures across species to identify conserved and divergent regions.

  • Correlation with Habitat: Analyze how sequence variations correlate with environmental adaptations.

  • Experimental Validation: Test the function of ancestral reconstructed proteins or chimeric proteins to verify evolutionary hypotheses.

The spinach genome has been extensively studied, with research revealing its evolutionary history. No recent whole genome duplication events have been observed in spinach, and genome syntenic analysis between spinach and sugar beet suggests substantial inter- and intra-chromosome rearrangements during the Caryophyllales genome evolution .

What are the differences in expression patterns and regulation of Chlorophyll a-b binding protein genes between wild and domesticated spinach varieties?

This comparison requires:

  • Transcriptome Analysis: Compare gene expression across different tissues, developmental stages, and environmental conditions between wild and domesticated varieties. Existing transcriptome sequencing of 120 cultivated and wild spinach accessions provides valuable data for such analyses .

  • Promoter Analysis: Compare regulatory regions to identify differences in transcription factor binding sites.

  • Epigenetic Profiling: Analyze DNA methylation and histone modifications that may influence gene expression.

  • Functional Validation: Use reporter gene assays to test the activity of different promoter variants.

  • Analysis of Domestication: Examine how artificial selection during domestication has affected gene regulation. Research suggests that S. turkestanica is likely the direct progenitor of cultivated spinach and spinach domestication has a weak bottleneck .

What spectroscopic techniques are most informative for studying the interactions between the recombinant protein and chlorophyll molecules?

A comprehensive spectroscopic analysis should include:

  • Absorption Spectroscopy: Measure the absorption spectra of bound versus free chlorophyll to detect shifts indicating protein-pigment interactions.

  • Circular Dichroism: Analyze the chirality induced in bound pigments to understand their orientation within the protein binding site.

  • Fluorescence Spectroscopy: Measure fluorescence emission, excitation spectra, and fluorescence lifetimes to characterize energy transfer processes.

  • Resonance Raman Spectroscopy: Provide information about specific vibrational modes of chlorophyll when bound to the protein.

  • Time-Resolved Spectroscopy: Study the dynamics of energy transfer and dissipation on picosecond to nanosecond timescales.

  • Single-Molecule Spectroscopy: Detect heterogeneity in protein-pigment interactions that may be masked in ensemble measurements.

How can molecular dynamics simulations complement experimental approaches in understanding Chlorophyll a-b binding protein function?

Molecular dynamics simulations offer several advantages:

  • Atomistic Detail: Provide insights into protein-pigment and protein-lipid interactions at atomic resolution, beyond what most experimental techniques can achieve.

  • Dynamic Information: Reveal conformational changes, water and ion movements, and transient interactions on nanosecond to microsecond timescales.

  • Parameter Testing: Allow systematic variation of conditions (temperature, pH, membrane composition) to predict effects on protein function.

  • Integration with Experiments:

    • Use experimental structures as starting points

    • Validate simulations against spectroscopic measurements

    • Generate testable hypotheses for further experiments

    • Interpret experimental data in structural context

  • Energy Transfer Simulation: Model excitation energy transfer between chlorophyll molecules to understand the physical basis of light harvesting efficiency.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.