Recombinant Spinacia oleracea Chlorophyll a-b binding protein CP24, chloroplastic

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Spinacia oleracea Chlorophyll a-b Binding Protein CP24, Chloroplastic

The Recombinant Spinacia oleracea Chlorophyll a-b binding protein CP24, chloroplastic is a recombinant form of a protein found in spinach (Spinacia oleracea). This protein is part of the light-harvesting complex in photosynthesis, specifically involved in binding chlorophyll a and b pigments. The recombinant version is engineered for research purposes, often used in studies related to photosynthesis and plant biology.

Biological Function and Structure

  • Biological Function: The CP24 protein plays a role in the light-harvesting complex of photosystem II (PSII) in chloroplasts. It binds chlorophyll a and b, facilitating the absorption of light energy, which is crucial for photosynthesis .

  • Structure: The recombinant CP24 protein is typically produced with a His-tag for easier purification. It spans amino acids 52-261 in the native protein sequence .

Applications and Availability

  • Applications: The recombinant CP24 protein is used in scientific research, particularly in studies related to photosynthesis and plant biology. It can be utilized in experiments to understand the mechanisms of light harvesting and energy transfer.

  • Availability: Recombinant CP24 is available for purchase from various biotechnology suppliers, often as a His-tagged protein for research purposes .

Data and Tables

While specific data tables are not readily available for the recombinant CP24 protein itself, research on light-harvesting complexes provides insights into their function and efficiency. For example, studies on the light-harvesting properties of chlorophyll a and b in photosystem II complexes show that chlorophyll b contributes significantly to light harvesting, especially in the Qy region .

PigmentContribution to Light Harvesting
Chlorophyll aEssentially unchanged in LHCII
Chlorophyll bEnhanced by 20% in LHCII
CarotenoidsReduced by 33% in LHCII

This table illustrates the relative contributions of different pigments in the light-harvesting complex II (LHCII), which includes CP24, under natural daylight conditions .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Chlorophyll a-b binding protein CP24, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
52-261
Protein Length
Full Length of Mature Protein
Species
Spinacia oleracea (Spinach)
Target Protein Sequence
AAAAPKKSWIPAVKGGGNFLDPEWLDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGRW AMLAVLGIFVGQAWTGIPWFEAGADPGAVAPFSFGTLLGTQLLLMGWVESKRWVDFFDPD SQSVEWATPWSRTAENFSNSTGEQGYPGGKFFDPLSLAGTISNGVYNPDTDKLERLKLAE IKHARLAMLAMLIFYFEAGQGKTPLGALGL
Uniprot No.

Target Background

Protein Families
ELIP/psbS family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What pigment molecules are bound to CP24 and how are they arranged?

CP24 contains a specific arrangement of chlorophyll and carotenoid molecules that are crucial for its light-harvesting function. Based on structural studies, CP24 binds:

  • Multiple chlorophyll a (Chl-a) molecules

  • Multiple chlorophyll b (Chl-b) molecules

  • A β-carotenoid (BCR)

  • A xanthophyll (XAT)

  • A lutein (LUT)

The arrangement of these pigments is critical for efficient energy capture and transfer. The chlorophyll molecules form clusters within the protein matrix that facilitate excitation energy transfer. Molecular dynamics simulations and quantum mechanical/molecular mechanical (QM/MM) studies have revealed three independent strongly coupled chlorophyll clusters within the complex . The phytyl tails of these chlorophyll molecules, which were not resolved in cryo-EM structures, extend into the membrane environment and contribute to the stability of the complex .

How does CP24 differ from other light-harvesting complex proteins?

CP24 has several distinctive features compared to other light-harvesting complex proteins:

  • Evolutionary distribution: CP24 is present in land plants but notably absent in certain species such as green algae, suggesting a specialized role in land plant photosynthesis .

  • Functional impact: Plants lacking the CP24 complex show reduced photosynthetic efficiency due to alterations in the structural organization of PSII .

  • Structural role: CP24 contributes uniquely to the assembly and stabilization of the PSII-LHCII supercomplex, particularly in binding LHCII trimers to PSII .

  • Pigment composition: While the general architecture of chlorophyll binding is similar to other LHC proteins, CP24 has a specific pigment stoichiometry and arrangement that distinguishes it from major LHCII complexes and other minor antenna complexes like CP29 .

What methodologies are most effective for expressing and purifying recombinant CP24?

For recombinant expression and purification of CP24 from Spinacia oleracea, researchers should consider the following methodological approach:

  • Gene cloning: The CP24 coding sequence should be amplified from spinach cDNA or synthesized based on the known sequence. For optimal expression, codon optimization for the host organism may be necessary.

  • Expression system selection: E. coli is commonly used, but because CP24 is a membrane protein with cofactors, eukaryotic expression systems may yield better results for properly folded protein. Some successful approaches include:

    • Cell-free expression systems for membrane proteins

    • Pichia pastoris for eukaryotic expression

    • Insect cell expression systems using baculovirus vectors

  • Purification strategy:

    • Initial extraction using detergents suitable for membrane proteins (such as n-dodecyl-β-D-maltoside)

    • Immobilized metal affinity chromatography (IMAC) using His-tags

    • Size exclusion chromatography for further purification

    • Ion exchange chromatography to separate different conformational states

  • Reconstitution with pigments: For functional studies, the protein often needs to be reconstituted with chlorophylls and carotenoids, which can be achieved by:

    • Co-expression with chlorophyll biosynthesis genes

    • In vitro reconstitution using purified pigments

  • Quality control: The functional integrity should be verified through:

    • Absorption and fluorescence spectroscopy

    • Circular dichroism to confirm secondary structure

    • Pigment analysis by HPLC

How can quantum mechanical approaches be used to study energy transfer dynamics in CP24?

Quantum mechanical approaches offer powerful tools for studying the energy transfer dynamics in CP24. Recent research has employed several sophisticated methods:

  • TD-LC-DFTB/MM methodology: Time-dependent density functional tight binding combined with molecular mechanics has been shown to efficiently determine excitation energies for chlorophyll molecules . This approach calculates the Q_y excitation energies (site energies) for chlorophyll pigments along molecular dynamics trajectories.

  • Long-timescale simulations: Extended molecular dynamics simulations (3 μs) of CP24 in a membrane environment provide comprehensive atomistic descriptions of the protein dynamics . These simulations capture environmental fluctuations that affect pigment energetics.

  • Spectral density calculations: From site energy fluctuations, spectral densities critical for density matrix calculations can be modeled. These spectral densities characterize the coupling between electronic states and vibrational modes .

  • Exciton dynamics modeling: Using the site energies and couplings obtained from quantum mechanical calculations, researchers can construct a time-dependent Hamiltonian to model exciton dynamics through:

    • Redfield theory approaches

    • Hierarchical equations of motion (HEOM)

    • Modified Redfield theory

  • Integration with experimental data: The computational results should be validated against experimental measurements such as:

    • Time-resolved fluorescence spectroscopy

    • Two-dimensional electronic spectroscopy

    • Transient absorption measurements

These approaches have revealed three independent strongly coupled chlorophyll clusters within CP24 and provided insights into the energy transfer pathways critical for photosynthetic efficiency .

What structural techniques provide the most detailed insights into CP24-pigment interactions?

Several complementary structural techniques offer detailed insights into CP24-pigment interactions:

How does the absence of CP24 affect PSII-LHCII supercomplex organization and function?

The absence of CP24 has significant impacts on both the structural organization and functional performance of the PSII-LHCII supercomplex:

This research highlights CP24's importance not just as a light-harvesting component but as a structural element critical for the proper assembly and function of the photosynthetic apparatus in higher plants.

What are the optimal protocols for studying CP24 site energy fluctuations using molecular dynamics?

To study CP24 site energy fluctuations using molecular dynamics, researchers should follow these optimized protocols based on recent successful approaches:

  • System preparation:

    • Start with a high-resolution structure of CP24 (e.g., from PDB ID: 5XNL)

    • Reconstruct missing segments (such as phytyl tails of chlorophylls) using appropriate modeling tools (GAUSSIAN, CHIMERA, VMD)

    • Embed the complex in a lipid bilayer using tools like CHARMM-GUI

    • Solvate the system with explicit water and add appropriate ions

  • Force field selection:

    • For protein: AMBER03 force field

    • For lipid bilayer: Lipid-17 force field

    • For Chl-a/b and carotenoids: specifically parameterized force fields from literature

  • Simulation protocol:

    • Energy minimization followed by gradual equilibration:

      • NVT equilibration at 300 K with position restraints

      • Multi-step NPT equilibration gradually releasing restraints

    • Production run length: At least 3 μs for comprehensive sampling

    • Time step: 2 fs with SHAKE algorithm for bond constraints

  • Analysis of pigment environments:

    • Extract multiple conformations using PCA for subsequent QM/MM calculations

    • Monitor pigment-protein hydrogen bonding networks

    • Track water molecules that may coordinate with chlorophylls

    • Analyze protein dynamics around pigment binding sites

  • Quantum calculations:

    • Perform TD-LC-DFTB calculations on extracted frames to obtain Q_y excitation energies

    • Calculate spectral densities from site energy fluctuations

    • Determine excitonic couplings based on pigment distances and orientations

This approach has successfully captured important features like water coordination to Chl-b 608, which was observed to occur only after approximately 1 μs in the simulations, demonstrating the necessity of extended simulation times .

How can researchers accurately measure CP24 binding affinities and interactions with other PSII components?

Accurately measuring CP24 binding affinities and interactions with other PSII components requires a multi-technique approach:

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified CP24 or potential binding partners on sensor chips

    • Measure real-time binding kinetics (kon and koff rates)

    • Determine equilibrium dissociation constants (KD)

    • Analyze binding under varying conditions (pH, ionic strength, temperature)

  • Microscale Thermophoresis (MST):

    • Label CP24 with fluorescent dyes or use intrinsic fluorescence

    • Measure thermophoretic movement in response to binding

    • Determine binding affinities in solution without immobilization

  • Isothermal Titration Calorimetry (ITC):

    • Directly measure thermodynamic parameters of binding (ΔH, ΔS, ΔG)

    • Provide stoichiometry information without labeling

    • Reveal enthalpy-entropy compensation mechanisms

  • Co-immunoprecipitation combined with mass spectrometry:

    • Identify binding partners in complex mixtures

    • Validate interactions in near-native conditions

    • Detect transient or weak interactions

  • Cross-linking mass spectrometry:

    • Identify specific residues involved in protein-protein interactions

    • Map binding interfaces at the molecular level

    • Provide evidence for higher-order organization

  • Fluorescence techniques:

    • Förster Resonance Energy Transfer (FRET) to measure distances between labeled components

    • Fluorescence Recovery After Photobleaching (FRAP) to analyze mobility and complex formation

    • Fluorescence Correlation Spectroscopy (FCS) to determine diffusion coefficients and complex sizes

These complementary approaches provide a comprehensive understanding of binding affinities, kinetics, thermodynamics, and structural details of CP24 interactions with other PSII components.

What techniques are most effective for analyzing the impact of post-translational modifications on CP24 function?

Analyzing the impact of post-translational modifications (PTMs) on CP24 function requires an integrated experimental approach:

  • Identification of PTMs:

    • Mass spectrometry-based proteomics to identify phosphorylation, glycosylation, or other modifications

    • Enrichment techniques for specific PTMs (e.g., TiO2 for phosphopeptides)

    • Site-specific antibodies to detect known modifications

    • Considerations from RNA-binding protein studies may be relevant, as the 24 kDa RNA-binding protein from spinach chloroplasts has been shown to undergo phosphorylation

  • Site-directed mutagenesis:

    • Generate variants where modified residues are replaced with non-modifiable amino acids

    • Create phosphomimetic mutations (e.g., Ser to Asp/Glu) to simulate constitutive phosphorylation

    • Develop a library of mutants with combinations of modified sites

  • Functional assays:

    • Measure binding affinities for other PSII components before and after modification

    • Assess pigment binding properties and spectral characteristics

    • Evaluate energy transfer efficiency using time-resolved fluorescence spectroscopy

    • Analyze supercomplex assembly using native gel electrophoresis

  • Structural analysis:

    • Compare structures of modified and unmodified proteins using cryo-EM or X-ray crystallography

    • Employ NMR to detect local structural changes induced by modifications

    • Use molecular dynamics simulations to predict effects of modifications on protein dynamics

  • In vivo studies:

    • Generate transgenic plants expressing wild-type or modified CP24

    • Assess photosynthetic parameters and plant growth under various conditions

    • Analyze adaptation to different light conditions and stresses

This comprehensive approach can reveal how PTMs like phosphorylation may regulate CP24 function, potentially by altering binding affinities, protein stability, or energy transfer properties, similar to the decreased RNA binding affinity observed in phosphorylated RNA-binding proteins from chloroplasts .

How can researchers overcome challenges in obtaining high-resolution structures of CP24 in different conformational states?

Obtaining high-resolution structures of CP24 in different conformational states presents several challenges that researchers can address through these methodological approaches:

  • Cryo-EM optimization for membrane proteins:

    • Use detergent screening to identify optimal solubilization conditions

    • Employ nanodiscs or amphipols to maintain native-like lipid environments

    • Implement the GraFix method to stabilize different conformational states

    • Utilize time-resolved cryo-EM with rapid freezing after stimulation to capture transient states

  • Improving sample homogeneity:

    • Develop rigorous purification protocols with multiple chromatography steps

    • Utilize analytical ultracentrifugation to identify and separate different oligomeric states

    • Implement chemical crosslinking to stabilize specific conformations

    • Use computational sorting of particle images to separate distinct conformational states

  • Advanced structural techniques:

    • Single-particle cryo-EM with focused refinement on flexible regions

    • Cryo-electron tomography combined with subtomogram averaging for in situ structural determination

    • Integrative modeling approaches combining low-resolution data from multiple techniques

    • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions

  • Computational approaches:

    • Enhanced sampling molecular dynamics (such as replica exchange MD) to explore conformational space

    • Markov state modeling to identify metastable states and transition pathways

    • Machine learning approaches to predict conformational changes based on sequence and existing structural data

  • Validation strategies:

    • Cross-validate structures using orthogonal techniques (SAXS, SANS, EPR)

    • Perform functional assays to correlate structural states with specific functions

    • Use site-directed spin labeling combined with DEER spectroscopy to measure distances between specific residues

The combination of these approaches has proven successful in recent studies of membrane protein complexes, including photosynthetic systems like the C₄S₄M₂-type PSII-LHCII megacomplex that was resolved to 3.22 Å .

What are the best techniques for measuring excitation energy transfer in CP24 across different timescales?

Measuring excitation energy transfer in CP24 across different timescales requires a complementary set of spectroscopic techniques:

  • Femtosecond timescale (10⁻¹⁵ to 10⁻¹² s):

    • Ultrafast transient absorption spectroscopy to track initial energy transfer events

    • Two-dimensional electronic spectroscopy (2DES) to map energy pathways with high temporal and spectral resolution

    • Fluorescence upconversion to measure early fluorescence dynamics with sub-picosecond resolution

  • Picosecond timescale (10⁻¹² to 10⁻⁹ s):

    • Time-resolved fluorescence spectroscopy using:

      • Time-correlated single photon counting (TCSPC)

      • Streak camera detection

    • These methods have been successfully employed to probe altered excitation energy transfer landscapes in photosystem complexes

  • Nanosecond timescale (10⁻⁹ to 10⁻⁶ s):

    • Time-resolved fluorescence anisotropy to monitor rotational dynamics

    • Pulse-probe spectroscopy with nanosecond lasers

    • Phosphorescence measurements for triplet state dynamics

  • Steady-state measurements:

    • Absorption and fluorescence spectroscopy at different temperatures

    • Circular dichroism spectroscopy to analyze pigment-protein interactions

    • Resonance Raman spectroscopy to probe vibrational modes coupled to electronic transitions

  • Data analysis approaches:

    • Global and target analysis of time-resolved data to extract transfer rates and pathways

    • Förster resonance energy transfer (FRET) modeling

    • Comparison with calculated excitation energy transfer rates from quantum mechanics

This multi-technique approach has been applied successfully, as evidenced by studies combining ultrafast time-resolved fluorescence spectroscopy with structural data to probe the altered excitation energy transfer in photosystem membranes .

What are the key spectral properties of CP24 and its pigment components?

The spectral properties of CP24 and its pigment components are critical for understanding its light-harvesting function. Key spectral data includes:

Table 1: Pigment Composition of CP24 Complex

SubunitChlorophyllsCarotenoidsLipidsOthers
CP2410 Chl a/b1 BCRMultiple MGDG, DGDG, SQDG-
1 XAT
1 LUT

Table 2: Average Site Energies of Chlorophylls in CP24

Based on TD-LC-DFTB/MM calculations, the Q_y excitation energies of chlorophylls in CP24 exhibit distinct patterns that affect energy transfer pathways . These site energies fluctuate due to protein environment dynamics and contribute to the spectral properties of the complex.

Key spectral characteristics:

  • Absorption spectrum: CP24 shows characteristic peaks corresponding to chlorophyll a (around 430 and 660 nm) and chlorophyll b (around 450 and 640 nm), with specific peak positions and intensities dependent on the protein environment .

  • Fluorescence spectrum: The complex exhibits fluorescence emission primarily around 680 nm, reflecting energy transfer to the lowest energy chlorophyll states .

  • Spectral densities: Each chlorophyll molecule in CP24 has a unique spectral density derived from site energy fluctuations, reflecting its specific protein environment . These spectral densities are crucial inputs for density matrix calculations and accurate modeling of energy transfer dynamics.

  • Exciton states: The excited states of CP24 are delocalized across multiple chlorophyll molecules, with the extent of delocalization dependent on the coupling strength and energy difference between pigments .

Understanding these spectral properties is essential for elucidating the energy transfer pathways and quantum coherence effects that contribute to the efficiency of photosynthetic light harvesting.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.