Recombinant Spinacia oleracea Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Introduction

The Recombinant Spinacia oleracea Chloroplast Envelope Membrane Protein (cemA) is a key transmembrane protein localized to the inner envelope membrane of spinach chloroplasts. It plays a critical role in chloroplast physiology, particularly in ion transport and maintaining stromal pH during photosynthesis . Recombinant production enables detailed structural and functional studies, advancing research on chloroplast metabolism and bioengineering.

Protein Structure

  • Gene: cemA (UniProt ID: Q9M3L4) .

  • Sequence: 229 amino acids (1-229aa) , with a full-length sequence including transmembrane domains critical for membrane integration .

  • Domains: Predicted multiple α-helical transmembrane regions, consistent with its role as an integral membrane transporter .

Physicochemical Properties

ParameterValue
Molecular Weight~27–28 kDa (theoretical)
Isoelectric Point (pI)>8.8 (basic)
Expression SystemE. coli (His-tagged)
Purity>90% (SDS-PAGE verified)

Expression and Purification

  • Host: Expressed in E. coli with an N-terminal His tag for affinity chromatography .

  • Form: Lyophilized powder in Tris/PBS-based buffer (pH 8.0) with 6% trehalose .

  • Reconstitution: Solubilized in sterile water (0.1–1.0 mg/mL) with optional glycerol (5–50%) for stability .

Role in Chloroplast Physiology

  • Proton Extrusion: Indirectly supports inorganic carbon uptake into chloroplasts, essential for photosynthesis .

  • Transport Mechanisms: Part of a network of inner envelope transporters regulating metabolite flux and pH balance .

Enzymatic and Redox Activities

While cemA itself is not an enzyme, chloroplast envelope membranes host redox-active components (e.g., Fe-S centers and semiquinone radicals) . cemA’s structural role may facilitate interactions with these systems to regulate electron transfer and oxidative pathways .

Key Uses

  • Antibody Production: Immunogen for raising antibodies against chloroplast envelope proteins .

  • Structural Studies: Analysis of transmembrane topology and interactions .

  • Functional Assays: Reconstitution in liposomes to study transport kinetics .

Comparative Analysis of Chloroplast Envelope Transporters

FeaturecemAOther Envelope Transporters (e.g., IEP60, IEP45)
TM Domains4–13 predicted4–12
Subcellular LocationInner envelope membraneInner envelope membrane
pI>8.8>8.8
FunctionProton/carbon transportMetabolite transport

Future Directions

  • Mechanistic Studies: Elucidate cemA’s role in carbon-concentrating mechanisms.

  • Biotechnological Applications: Engineer chloroplast transporters to enhance photosynthetic efficiency in crops.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will strive to fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preference for a particular tag type, please inform us, and we will prioritize its development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Spinacia oleracea (Spinach)
Target Names
cemA
Target Protein Sequence
MEKKKVFIPFLYLISIVFLPWWIYLSFQKSLESWVTTWWNTKQSETFLNDIQEKKLLEKF IELEELRLLDEMIKEYPETQLQKLGIGIHNETIQLIKMHNEDCIHMILHFSTNLICFLIL GGYSILGNKELILLNSWVQEFLYNLSDTIKAFSILLVTDLCIGFHSPQGWELLIESIYKD FGFADNDQIISSLVSTFPVILDTILKYWIFRSLNRVSPSLVVIYHSMND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion. It indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Database Links

KEGG: soe:2715581

Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.