Recombinant Spinacia oleracea Cytochrome b6-f complex iron-sulfur subunit, chloroplastic (petC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petC; Cytochrome b6-f complex iron-sulfur subunit, chloroplastic; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein; Rieske iron-sulfur protein; ISP; RISP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
52-230
Protein Length
Full Length of Mature Protein
Species
Spinacia oleracea (Spinach)
Target Names
petC
Target Protein Sequence
ATSIPADNVPDMQKRETLNLLLLGALSLPTGYMLLPYASFFVPPGGGAGTGGTIAKDALG NDVIAAEWLKTHAPGDRTLTQGLKGDPTYLVVESDKTLATFGINAVCTHLGCVVPFNAAE NKFICPCHGSQYNNQGRVVRGPAPLSLALAHCDVDDGKVVFVPWTETDFRTGEAPWWSA
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the structure and function of the Spinacia oleracea PetC protein?

The PetC protein (Rieske iron-sulfur subunit) is a central component of the cytochrome b6f complex in chloroplast and cyanobacterial thylakoid membranes. It contains a characteristic [2Fe-2S] cluster with one iron coordinated by two cysteine residues and the other iron coordinated by two histidine residues, forming what is known as a "Rieske-type" cluster. The protein plays a critical role in photosynthetic electron transport, transferring electrons from plastoquinol to cytochrome f, which ultimately contributes to the proton gradient used for ATP synthesis.

The Rieske protein contains a highly conserved metal-binding amino acid sequence motif, CXHX15–21CX2H, which includes the two cysteine and two histidine residues that coordinate the [2Fe-2S] cluster . In spinach PetC, these conserved residues are Cys42, His44, Cys62, and His65.

What is known about the genetic characteristics of spinach PetC?

Spinach (Spinacia oleracea L.) is traditionally known as a dioecious species, with separate male and female plants. Sex expression in dioecious spinach plants is controlled by a single gene pair termed X and Y. The PetC gene in spinach is located on linkage group 3 of the spinach molecular map, as indicated by previous studies . Understanding the genetic context is important when working with recombinant spinach proteins, as genetic variation may affect protein expression and function.

What are the most effective systems for recombinant expression of spinach PetC?

Several expression systems have been developed for the recombinant production of spinach PetC in E. coli, with varying degrees of success:

  • MalE fusion system: Plasmids for expression of full-length and truncated Spinacia oleracea Rieske (PetC) proteins fused to MalE (maltose binding protein) have proven particularly effective. The expressed fusion proteins are predominantly found (55-70%) in the cytoplasm in a soluble form, facilitating subsequent purification .

  • Affinity tag systems: Single affinity chromatography steps using amylose resin for MalE fusion proteins have yielded approximately 15mg of protein from 1 liter of E. coli culture .

For researchers working with this system, it's important to note that the expression of PetC in E. coli typically produces the apoprotein (without the iron-sulfur cluster), which requires subsequent reconstitution for functional studies.

What methods are effective for purifying recombinant spinach PetC?

The purification of recombinant spinach PetC can be achieved through several approaches:

  • Affinity chromatography: For MalE fusion proteins, amylose resin affinity chromatography provides a single-step purification method that yields electrophoretically pure protein suitable for further experiments .

  • Size exclusion chromatography: This can be used as a final purification step to achieve high purity, as demonstrated with other recombinant chloroplast proteins like ferredoxin-NADP+ reductase (FNR) .

A typical purification protocol yields at least 1 mg of homogeneous protein per gram of cells (fresh weight), allowing for sufficient material for subsequent structural and functional analyses.

What are the available methods for reconstituting the [2Fe-2S] cluster into the PetC apoprotein?

Two primary methods for reconstituting the [2Fe-2S] cluster into recombinant spinach PetC apoprotein have been described:

  • Chemical reconstitution: This method employs reduced iron and sulfide under controlled conditions. The incorporation of the cluster can be monitored by electron paramagnetic resonance (EPR) and optical circular dichroism (CD) spectroscopy .

  • Enzymatic reconstitution: The NifS-like protein IscS from the cyanobacterium Synechocystis PCC 6803 mediates the incorporation of 2Fe-2S clusters into the Rieske apoprotein in vitro. This approach has been successfully used for both full-length and truncated Rieske fusion proteins, with the presence of the cluster confirmed by EPR spectroscopy .

Research indicates that the spinach Rieske apoprotein must be in a partially folded conformation to incorporate an appropriate iron-sulfur cluster. Upon cluster integration, further folding occurs, allowing the protein to attain its final, native structure .

How can researchers verify successful reconstitution of the [2Fe-2S] cluster?

Several spectroscopic methods can confirm the successful reconstitution of the [2Fe-2S] cluster:

  • Electron Paramagnetic Resonance (EPR) spectroscopy: This technique can verify the presence and integrity of the [2Fe-2S] cluster in the reconstituted protein .

  • Optical Absorption Spectroscopy: The characteristic absorption spectrum of properly reconstituted Rieske-type [2Fe-2S] clusters shows distinct features in the near-UV and visible regions .

  • Circular Dichroism (CD) spectroscopy: CD spectral analysis in both the ultraviolet and visible regions can provide information about both protein folding and the environment of the [2Fe-2S] cluster .

  • X-ray Absorption Spectroscopy: This technique can provide detailed information about the coordination environment of the iron atoms in the cluster .

How do mutations in the histidine ligands affect the properties of the [2Fe-2S] cluster?

Studies on Rieske proteins have shown that mutations in the histidine ligands of the [2Fe-2S] cluster significantly affect its properties:

  • Redox potential effects: Replacement of histidine ligands with cysteine residues lowers the reduction potential by approximately 175-300 mV, as demonstrated in various Rieske proteins . This alteration fundamentally changes the electron transfer properties of the protein.

  • Stability effects: The histidine ligands are critical for stabilizing the reduced form of the [2Fe-2S] cluster. When these residues are mutated, the reduced cluster becomes unstable, as evidenced by changes in the near-UV and visible absorption spectra .

  • Enzymatic activity impact: Mutations of the histidine ligands severely impair electron transfer activity. For example, in BphA3 (a bacterial Rieske-type ferredoxin), mutants with histidine to cysteine substitutions showed less than 0.3% of the wild-type protein's cytochrome c reductase activity .

These findings indicate that while histidine ligands in Rieske proteins can be replaced with cysteine residues (resulting in a [2Fe-2S] cluster with four cysteine ligands), the native histidine coordination is essential for proper electron transfer function.

What is the significance of the proton-coupled electron transfer (PCET) in PetC function?

The Rieske iron-sulfur protein functions as a proton pump, essential to almost all living organisms. Research has revealed several important aspects of the proton-coupled electron transfer (PCET) in PetC:

  • Proton acceptance stoichiometry: Studies suggest that approximately 0.2–0.5 stoichiometric equivalents of protons are accepted by the histidine ligand H154, per electron in truncated Rieske proteins (with H2O as a proton donor) . This stoichiometry might be different in vivo when the protein is in complex with other components.

  • 2PCET process: Evidence indicates that in certain pH ranges, the Rieske protein can acquire two net protons for every electron accepted (a 2PCET process). This 2:1 proton/electron stoichiometry is intriguingly similar to that of the Qo-site where the Rieske protein functions in the cytochrome b6f complex .

  • pKa modulation: In the Arabidopsis P194L (ISP) mutant (P144 in spinach), the pKa of the histidine ligands of the 2Fe-2S ISP cluster is upshifted by 1 pH unit, resulting in increased photosynthetic control (PCON) even under low light conditions . This demonstrates how subtle changes in the protein structure can significantly affect its proton-coupled electron transfer properties.

How can researchers use site-directed mutagenesis to study structure-function relationships in PetC?

Site-directed mutagenesis has been effectively applied to study the structure-function relationships in Rieske proteins:

  • Targeting conserved residues: Key conserved residues in the metal-binding motif (CXHX15–21CX2H) can be systematically replaced to analyze their role in cluster coordination, redox properties, and protein stability .

  • Portal residues: Studies on the cytochrome b6f complex have identified specific proline residues (e.g., Pro105 and Pro112) that create a bend in the F-helix, affecting the portal aperture for plastoquinol binding and electron transfer . Changing these prolines to alanines resulted in a 30-50% decrease in growth rate and reduction of photo-oxidized cytochrome f.

  • Redox-dependent conformational changes: Detailed investigations have shown that prolyl residues near the iron-sulfur cluster can undergo redox-state-dependent conformational changes, with some peptide bonds changing from trans to cis configuration upon reduction . These structural changes may alter interactions between the Rieske protein and other components of the complex.

To effectively implement site-directed mutagenesis, researchers can follow these methodological steps:

  • Design primers containing the desired mutation with appropriate restriction sites

  • Use PCR-based mutagenesis techniques

  • Confirm mutations by DNA sequencing

  • Express and purify mutant proteins

  • Analyze the effects of mutations on structure and function using spectroscopic and biochemical methods

What approaches can be used to study the interaction of PetC with other components of the cytochrome b6f complex?

Several methods can be employed to investigate the interactions between PetC and other components of the cytochrome b6f complex:

  • Isothermal Titration Calorimetry (ITC): This technique can be used to study binding thermodynamics between purified components. For example, ITC has been used to examine potential interactions between the cytochrome b6f complex and other proteins like PGRL1, although in that particular case no detectable interaction was found .

  • NMR spectroscopy: Solution NMR can provide detailed information about redox-state-dependent and ligand-dependent conformational changes in the Rieske protein, as well as interactions with other proteins or small molecules like quinone analogues .

  • X-ray crystallography: High-resolution structures (such as the 2.5 Å crystal structure of the cyanobacterial b6f complex) provide valuable insights into the interactions between the Rieske iron-sulfur protein and other subunits within the complete complex .

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry can identify points of contact between PetC and other proteins in the complex.

  • In vitro reconstitution experiments: Reconstituting partial or complete complexes with purified components can help elucidate the role of specific interactions in complex assembly and function.

What strategies can address low yields or insoluble expression of recombinant PetC?

Researchers encountering issues with expression of recombinant spinach PetC can implement several strategies:

  • Fusion protein approaches: Fusion to solubility-enhancing partners like MalE (maltose binding protein) has proven effective in producing soluble PetC, with 55-70% of the expressed protein found in soluble form in the cytoplasm .

  • Expression optimization: Adjusting induction conditions (temperature, IPTG concentration, duration) can significantly improve protein solubility and yield.

  • Truncation strategies: Expression of truncated versions of the protein (removing membrane-spanning domains) can enhance solubility while maintaining the functional domains containing the [2Fe-2S] cluster .

  • Codon optimization: Adapting the spinach PetC coding sequence to match E. coli codon usage preferences may improve translation efficiency and protein yield.

  • Chaperone co-expression: Co-expression with molecular chaperones can aid in proper protein folding and increase soluble yields.

What are the critical factors affecting successful reconstitution of the [2Fe-2S] cluster?

Several factors critically influence the successful reconstitution of the [2Fe-2S] cluster in recombinant spinach PetC:

  • Protein folding state: The spinach Rieske apoprotein must be in a partially folded conformation to incorporate an appropriate iron-sulfur cluster. Upon cluster integration, further folding occurs to achieve the native structure .

  • Reducing conditions: Maintaining appropriate reducing conditions during reconstitution is essential for proper cluster assembly.

  • Iron and sulfur source: The chemical method employs reduced iron and sulfide under controlled conditions, while the enzymatic method uses the NifS-like protein IscS as a sulfur donor .

  • pH and buffer conditions: These must be optimized to facilitate cluster incorporation without promoting protein aggregation or denaturation.

  • Oxygen exposure: Limiting oxygen exposure during reconstitution and subsequent handling is crucial to prevent oxidative damage to the iron-sulfur cluster.

When reconstitution efficiency is low, researchers should systematically evaluate and optimize these parameters to improve results.

How can structural biology approaches enhance our understanding of PetC function?

Recent structural biology advances have provided valuable insights into PetC function and offer promising directions for future research:

  • High-resolution structures: The 2.5 Å crystal structure of the cyanobacterial b6f complex (pdb 4OGQ) has provided detailed information about the organization of the complex, including the position and environment of the Rieske iron-sulfur protein .

  • Inhibitor-bound structures: Crystal structures of the b6f complex in the presence of inhibitors like stigmatellin, tridecyl-stigmatellin, and NQNO have revealed important details about the quinone binding sites and electron transfer pathways .

  • Cryo-EM advances: The application of cryo-electron microscopy to membrane protein complexes offers opportunities for studying the b6f complex under more native-like conditions and potentially capturing different conformational states.

  • Computational approaches: Molecular dynamics simulations based on structural data can provide insights into the dynamic aspects of PetC function, including conformational changes associated with electron transfer.

Future structural biology efforts might focus on:

  • Capturing different conformational states associated with the electron transfer cycle

  • Resolving structures of mutant proteins to understand structure-function relationships

  • Determining structures of PetC in complex with its interaction partners

What emerging technologies might impact future research on recombinant PetC?

Several emerging technologies have the potential to significantly advance research on recombinant spinach PetC:

  • CRISPR/Cas9-mediated genome editing: This technology could facilitate the creation of spinach plants with modified PetC genes, allowing in vivo studies of structure-function relationships.

  • Single-molecule techniques: Methods like single-molecule FRET could provide insights into the conformational dynamics of PetC during electron transfer.

  • Time-resolved spectroscopy: Advanced spectroscopic techniques with improved temporal resolution can capture transient states in the electron transfer process.

  • Cell-free protein synthesis: These systems might offer advantages for the production of membrane proteins like PetC, potentially with co-translational incorporation of the iron-sulfur cluster.

  • Synthetic biology approaches: The redesign of PetC with altered properties (e.g., redox potential, substrate specificity) could lead to insights into its function and potentially applications in synthetic electron transfer systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.