Recombinant Spinacia oleracea Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Spinacia oleracea (Spinach)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMASVPAGLLTVPFLENVNKF QNPFRRPVATTVFLVGTVVALWLGIGATLPIDKSLTLGLF
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Database Links

KEGG: soe:2715599

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Cytochrome b6-f complex and what role does subunit 4 (petD) play within it?

The Cytochrome b6-f complex is a crucial membrane protein complex in the thylakoid membrane of chloroplasts that functions as an electron transfer complex in the photosynthetic electron transport chain. Subunit 4, encoded by the petD gene in Spinacia oleracea (spinach), is essential for the structural integrity and function of the complex. PetD forms a mildly protease-resistant subcomplex with Cytochrome b6 that serves as a template for the assembly of other components including Cytochrome f and PetG, ultimately producing a protease-resistant cytochrome moiety . This assembly pattern is critical for the stability of the entire complex, as PetD becomes more unstable in the absence of Cytochrome b6, and the synthesis of Cytochrome f is greatly reduced when either Cytochrome b6 or PetD is inactivated .

What is the genetic organization of the petD gene in Spinacia oleracea?

The petD gene in spinach chloroplasts encodes subunit IV of the cytochrome b6/f complex. Like many chloroplast mRNAs, the spinach petD mRNA contains a characteristic 3'UTR stem-loop structure that is crucial for correct 3' processing of the pre-mRNA and stability of the mature mRNA . This structural feature is important for post-transcriptional regulation. The gene is part of the petD/trnR1 region, which spans approximately 1.5 kb (481 bp upstream and 1032 bp downstream of petD) . Understanding this genetic organization is essential for designing recombinant expression systems and for manipulating the gene for research purposes.

How does the Cytochrome b6-f complex contribute to photosynthetic function?

The Cytochrome b6-f complex plays a central role in both cyclic and non-cyclic electron transport pathways in photosynthesis. Beyond its electron transport function, the b6f complex also activates the state-transition 7 kinase (STT7), which phosphorylates light-harvesting complex proteins, triggering their migration between photosystems to optimize light capture efficiency under changing light conditions . The complex thus serves as a critical junction in both energy production and photosynthetic regulation. PetD, as an integral subunit, is essential for these functions, making it an important target for research aimed at understanding photosynthetic regulation and potential improvement.

What expression systems are most effective for recombinant production of Spinacia oleracea petD?

Escherichia coli-based expression systems have proven effective for recombinant production of various spinach chloroplast proteins. For example, spinach ferredoxin I has been successfully overexpressed using a phage T7 promoter system (vector pET-11d), accounting for approximately 2.5% of soluble E. coli protein . Similar approaches can be adapted for petD expression, with consideration for the following methodological factors:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli T7High yield, rapid growthPotential folding issuesCodon optimization, use of specialty strains
Chloroplast transformationNative post-translational modificationsMore complex methodologyCo-expression with assembly factors
In vitro translationControl over reaction conditionsLower yieldOptimization of translation components

For petD specifically, co-expression with cytochrome b6 may be necessary to enhance stability, as PetD becomes unstable in the absence of cytochrome b6 . Additionally, considering the membrane-associated nature of the protein, expression strategies that facilitate proper membrane insertion or that can handle hydrophobic domains should be prioritized.

What are the critical considerations for designing recombinant petD constructs?

When designing recombinant constructs for petD expression, researchers should consider:

  • Codon optimization: Adjust codon usage to match the expression host while maintaining critical regulatory elements.

  • Fusion tags: Strategic placement of purification tags is crucial, as they must not interfere with protein folding or complex assembly. C-terminal tags are often preferred, as evidenced by successful approaches with other spinach proteins .

  • Signal sequences: For proper localization, especially in heterologous systems, appropriate signal sequences may be required.

  • Expression timing: Control of expression timing is important, as premature or excessive expression may lead to inclusion bodies.

  • Construct validation: Techniques such as restriction digestion and PCR should be used for validation, as demonstrated in the methodology for petD region cloning using SalI/EcoRI digestion followed by ligation into pUC18 vectors .

Additionally, the preservation of critical mRNA structural elements, such as the 3'UTR stem-loop structure that determines correct processing and stability of the mature mRNA, should be considered when designing constructs .

How does recombinant petD interact with other components of the Cytochrome b6-f complex?

The assembly of the Cytochrome b6-f complex follows a defined sequence where Cytochrome b6 and PetD form a mildly protease-resistant subcomplex that serves as a template for the assembly of Cytochrome f and PetG, producing a protease-resistant cytochrome moiety. Subsequently, PetC and PetL proteins participate in the assembly of the functional dimer .

Research methodologies to study these interactions include:

  • Co-immunoprecipitation: This technique has been used to demonstrate the interaction between complex components after pulse labeling of newly synthesized proteins .

  • Protease protection assays: The formation of protease-resistant subcomplexes indicates specific protein-protein interactions within the complex.

  • Pulse-chase experiments: These have revealed that in mutants lacking certain components (e.g., in the dac mutant), the rate of labeling of Cytochrome f and PetD was greatly reduced, while synthesis of Cytochrome b6 was not affected after pulse labeling for 30 minutes .

  • Yeast two-hybrid or split-GFP assays: These can be employed to detect specific interaction partners of recombinant petD.

What factors influence the stability of recombinant petD protein?

Several factors affect the stability of recombinant petD:

  • Presence of Cytochrome b6: PetD becomes more unstable in the absence of Cytochrome b6, indicating a stabilizing interaction between these proteins .

  • Temperature sensitivity: Maximum activity of some spinach proteins has been observed at specific temperatures (e.g., 40°C for phosphoribosyl diphosphate synthase from spinach), suggesting that temperature optimization is crucial for stability .

  • Ionic requirements: Many spinach chloroplast proteins have specific ion requirements. For instance, spinach phosphoribosyl diphosphate synthase has an absolute requirement for magnesium ions .

  • pH sensitivity: Optimal pH conditions (e.g., pH 7.6 for phosphoribosyl diphosphate synthase) can significantly affect protein stability and activity .

  • Presence of molecular chaperones: Co-expression with appropriate chaperones may enhance proper folding and stability.

Research strategies should incorporate these factors into experimental design to maximize protein stability and functional yield.

How can researchers effectively study the N-terminal region of petD, which is essential for Cytochrome b6-f function?

The N-terminal region of petD plays a critical role in the function of the Cytochrome b6-f complex . To study this region effectively, researchers can employ:

  • Site-directed mutagenesis: Systematic alteration of specific residues can identify critical amino acids for function, interaction, or stability.

  • Deletion analysis: Progressive truncation of the N-terminal region can reveal the minimal functional domain.

  • Domain swapping: Replacing the N-terminal region with equivalent domains from related species can identify conserved functional elements.

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry can identify interaction partners of the N-terminal region.

  • Structural analysis: X-ray crystallography or cryo-electron microscopy of the complex with focus on the petD N-terminal region can provide detailed structural insights.

When implementing these techniques, researchers should consider using a combination of in vivo and in vitro approaches to validate findings across different experimental contexts.

What are the most effective protocols for purifying recombinant petD for structural and functional studies?

Purification of recombinant petD presents challenges due to its membrane-associated nature. Based on successful approaches with other spinach proteins, the following protocol framework is recommended:

  • Cell lysis optimization: Gentle lysis methods (e.g., osmotic shock, freeze-thaw cycles) may preserve protein-protein interactions better than harsh mechanical disruption.

  • Detergent selection: The choice of detergent is critical for solubilizing membrane proteins while maintaining native structure. A comparative analysis of detergents (e.g., n-dodecyl-β-D-maltoside, digitonin) should be performed.

  • Affinity chromatography: If fusion tags are incorporated, corresponding affinity chromatography (e.g., His-tag with Ni-NTA) can be employed, as demonstrated in successful purification of other recombinant spinach proteins .

  • Size-exclusion chromatography: This technique can separate the intact complex from individual components or aggregates.

  • Functional verification: Activity assays (e.g., electron transfer capability) should be performed at each purification step to monitor functional integrity.

A rapid procedure for the purification of recombinant ferredoxin I from spinach yielded at least 1 mg of homogeneous protein per gram of cells (fresh weight) . Similar yields might be achievable for petD with optimized protocols.

How is the expression of petD regulated at the transcriptional and post-transcriptional levels?

The regulation of petD expression involves multiple levels of control:

  • Transcriptional regulation: While specific transcription factors controlling petD expression have not been detailed in the provided search results, transcriptome profiling of spinach has identified approximately 72,151 unigenes , suggesting a complex regulatory landscape.

  • mRNA processing: The spinach petD mRNA contains a 3'UTR stem-loop structure that determines correct 3' processing of the pre-mRNA and stability of the mature mRNA . A 41 kDa protein has been identified as a component of the petD mRNA 3'stem-loop:protein complex, suggesting a role in mRNA processing and/or stability regulation .

  • RNA-protein interactions: The 41 kDa protein that interacts with the petD mRNA 3'UTR is nuclear-encoded but chloroplast-localized, as indicated by the presence of a transit peptide . This suggests a nuclear contribution to the regulation of chloroplast gene expression.

  • Translation regulation: Altered efficiency of translation initiation can be visualized through analyzing ribosomal loading of specific RNAs, which may affect petD protein synthesis .

Research approaches to study these regulatory mechanisms include RNA gel shift assays, ribosome profiling, and analysis of polysome association.

What role does the 3'UTR of petD mRNA play in its regulation, and how can this be studied experimentally?

The 3'UTR of petD mRNA contains a stem-loop structure crucial for correct 3' processing and mRNA stability . To study this regulatory element:

  • RNA structure prediction: Computational tools can predict the secondary structure of the 3'UTR stem-loop.

  • Mutagenesis of the stem-loop: Systematic alterations of the stem-loop sequence can identify critical elements for function.

  • RNA-protein binding assays: Gel mobility shift assays have demonstrated that a 41 kDa protein interacts with the petD mRNA 3'UTR to form an RNA-protein complex . Similar approaches can identify additional interaction partners.

  • In vitro RNA processing assays: These can assess how modifications to the 3'UTR affect processing efficiency.

  • Reporter gene constructs: Fusion of the petD 3'UTR to reporter genes can assess its impact on mRNA stability and translation efficiency in vivo.

The 41 kDa protein that interacts with the petD 3'UTR has been expressed in E. coli and purified, enabling in vitro studies of this interaction . This approach can be extended to study other potential regulatory proteins.

How conserved is the petD gene across different plant species, and what does this tell us about its evolutionary importance?

Comparative analysis of petD across plant species can provide insights into its evolutionary conservation and functional significance. Transcriptome sequencing of different Spinacia species (S. oleracea, S. turkestanica, and S. tetrandra) has identified approximately 320,000 high-quality single nucleotide polymorphisms (SNPs) , which can be used to assess genetic variation.

Phylogenetic analyses using SNPs and gene expression profiles have shown that S. turkestanica is more closely related to the cultivated S. oleracea than S. tetrandra . Similar comparative approaches can be applied specifically to the petD gene to understand its evolution within and beyond the Spinacia genus.

Research strategies for evolutionary studies include:

  • Sequence alignment and phylogenetic analysis: Comparing petD sequences across diverse plant species.

  • Identification of conserved domains: Detecting functionally critical regions that remain conserved despite evolutionary distance.

  • Selection pressure analysis: Calculating dN/dS ratios to determine if petD is under purifying, neutral, or positive selection.

  • Structural comparison: Examining if structural features of petD and its mRNA (e.g., the 3'UTR stem-loop) are conserved across species.

How can recombinant petD be used to study evolutionary divergence in photosynthetic machinery?

Recombinant petD offers unique opportunities to study evolutionary divergence in photosynthetic machinery through:

  • Domain swapping experiments: Replacing domains of petD from one species with corresponding regions from another can reveal functional conservation or divergence.

  • Heterologous complementation: Testing if petD from one species can functionally replace the native gene in another species.

  • Biochemical characterization: Comparing kinetic parameters, stability, and interaction profiles of recombinant petD from different species.

  • Structural studies: Analyzing structural variations in recombinant petD proteins from evolutionary diverse plant species.

  • In vitro reconstitution: Assembling chimeric Cytochrome b6-f complexes with components from different species to assess compatibility.

These approaches can provide insights into how the photosynthetic machinery has evolved and adapted to different ecological niches.

How can CRISPR-Cas9 technology be applied to study the function of petD in vivo?

CRISPR-Cas9 technology offers powerful approaches to study petD function:

  • Gene knockout: Complete inactivation of petD to assess its essentiality and the resulting phenotype.

  • Domain-specific editing: Precise modification of specific domains or residues to assess their functional significance.

  • Promoter modification: Altering expression levels to study dosage effects.

  • Tagged variants: Introduction of epitope tags for in vivo tracking and purification.

  • Conditional knockout: Creating inducible systems to control petD expression temporally.

What are the methodological considerations for studying the role of petD in state transitions and dynamic photosynthetic responses?

State transitions involve the redistribution of light-harvesting complexes between photosystems to optimize light capture, and the Cytochrome b6-f complex plays a crucial role by activating state-transition 7 kinase (STT7) . To study petD's involvement:

  • Time-resolved spectroscopy: Measuring the kinetics of state transitions in systems with wild-type versus modified petD.

  • Phosphorylation assays: Monitoring STT7-mediated phosphorylation events in the presence of functional or mutated petD.

  • Fluorescence imaging: Tracking the movement of light-harvesting complexes in real-time using fluorescent proteins or dyes.

  • Thylakoid membrane fractionation: Isolating membrane domains to analyze protein distribution during state transitions.

  • Reconstitution experiments: In vitro assembly of membrane complexes with or without recombinant petD to assess its specific contribution.

These methodologies can be combined with environmental manipulations (e.g., changing light quality or intensity) to study dynamic responses under conditions that mimic natural fluctuations.

What are the main challenges in expressing and purifying functional recombinant petD, and how can they be overcome?

The expression and purification of functional recombinant petD face several challenges:

ChallengeExplanationSolution Strategies
Membrane protein natureHydrophobic domains can cause aggregationUse of specialized detergents; expression as fusion with soluble partners
Complex assembly dependencyPetD stability depends on interaction with Cytochrome b6Co-expression with Cytochrome b6; expression of fusion constructs
Post-translational modificationsPotential modifications required for functionUse of eukaryotic expression systems or in vitro modification
Correct foldingMembrane environment affects foldingExpression in membrane-mimetic environments; use of chaperones
Functional assessmentDifficulty in assessing isolated subunit functionDevelopment of specific activity assays; reconstitution into liposomes

Successful strategies have been demonstrated with other spinach proteins. For example, spinach ferredoxin I was overexpressed using a T7 promoter system and purified with a rapid procedure yielding at least 1 mg per gram of cells . The recombinant protein was fully assembled with its [2Fe-2S] cluster and active with its physiological partner, suggesting that similar successes might be achievable with petD through careful optimization.

How can researchers address the challenge of maintaining protein stability during structural studies of recombinant petD?

Structural studies of membrane proteins like petD present unique challenges for maintaining stability. Recommended approaches include:

  • Crystallization chaperones: Use of antibody fragments or nanobodies that bind to and stabilize specific conformations.

  • Lipid cubic phase crystallization: This technique can provide a more native-like environment for membrane proteins during crystallization.

  • Detergent screening: Systematic testing of different detergents to identify those that maintain native structure.

  • Thermostability assays: Methods like differential scanning fluorimetry can identify conditions that enhance stability.

  • Fusion partners: Strategic fusion with well-folding proteins can enhance stability and crystallizability.

For spinach proteins, specific conditions have been shown to enhance stability. For example, spinach phosphoribosyl diphosphate synthase showed maximal activity at 40°C at pH 7.6 , suggesting that temperature and pH optimization can significantly impact protein stability. Similar condition optimization should be performed for petD.

How can transcriptomic data be leveraged to enhance understanding of petD expression and function?

Transcriptomic approaches offer powerful tools for studying petD expression and regulation:

  • RNA-Seq analysis: Deep transcriptome sequencing has been successfully applied to spinach, generating approximately 100 million high-quality reads that were assembled into 72,151 unigenes . Similar approaches can focus specifically on petD expression under various conditions.

  • Differential expression analysis: Comparison of expression levels across tissues, developmental stages, or environmental conditions can reveal regulatory patterns. For instance, a large number of genes involved in responses to biotic and abiotic stresses were found to be differentially expressed between cultivated and wild spinach .

  • Co-expression network analysis: Identifying genes with expression patterns correlated with petD can reveal functional associations and regulatory networks.

  • Ribosome profiling: This technique can provide insights into translational regulation by measuring ribosome occupancy on petD mRNA.

  • Alternative splicing analysis: Though not specifically mentioned for petD, alternative processing might affect gene expression and protein variants.

The integration of transcriptomic data with functional studies of recombinant petD can provide a more comprehensive understanding of its role in photosynthesis and cellular physiology.

What proteomic approaches are most effective for studying the integration of recombinant petD into the Cytochrome b6-f complex?

Several proteomic approaches can be employed to study the integration of recombinant petD into the Cytochrome b6-f complex:

  • Blue native PAGE: This technique can separate intact protein complexes, allowing visualization of complex assembly and stability.

  • Cross-linking mass spectrometry (XL-MS): By chemically cross-linking interacting proteins followed by mass spectrometry, researchers can map protein-protein interaction interfaces within the complex.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can reveal regions of proteins that become protected or exposed upon complex formation.

  • Pulse-chase experiments with immunoprecipitation: This approach has been used to demonstrate that the rate of labeling of Cytochrome b6/f subunits (Cytochrome f and PetD) was greatly reduced in certain mutants .

  • Quantitative proteomics: Techniques like SILAC or TMT labeling can quantify changes in protein abundance and complex composition under different conditions.

  • Affinity purification coupled with mass spectrometry (AP-MS): This can identify interaction partners of petD within and beyond the Cytochrome b6-f complex.

These methods can be combined to provide complementary insights into the dynamics of complex assembly and the specific role of petD within the larger protein network.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.