Recombinant Spinacia oleracea Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Spinacia oleracea (Spinach)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTDAFASVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, this protein mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.
Database Links

KEGG: soe:2715598

Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome b6 (petB) and what is its role in photosynthesis?

Cytochrome b6, encoded by the petB gene in spinach, is a central component of the cytochrome b6f complex that plays a crucial role in photosynthetic electron transport. This complex functions as the electrical connection between photosystem II (PSII) and photosystem I (PSI) by oxidizing the PSII electron acceptor plastoquinone (PQ) and reducing the PSI electron donor plastocyanin (Pc). These electron transfer reactions are coupled to the generation of an electrochemical proton gradient across the thylakoid membrane, which drives ATP synthesis via ATP synthase . The cytochrome b6f complex thus serves as a critical link in the electron transport chain, enabling the conversion of light energy into chemical energy during photosynthesis.

How is the petB gene organized in the spinach plastid genome?

The petB gene is part of the psbB operon in the spinach plastid chromosome. This operon encodes four genes in the following order: the 51-kDa chlorophyll a apoprotein (psbB), the 10-kDa phosphoprotein (psbH) - both associated with photosystem II - followed by cytochrome b6 (petB) and subunit IV (petD) of the cytochrome b/f complex . Importantly, these genes are not expressed coordinately despite being part of the same operon. The operon is bordered by a single prokaryote-like promotor positioned before psbB and a putative factor-independent terminator with characteristic sequence elements following petD . RNA analysis has demonstrated that this region produces eighteen major RNA species, all derived from one DNA strand, arising through complex processing rather than multiple transcription initiation/termination events .

What is the RNA processing pattern of the petB gene?

The RNA maturation process for petB is complex and involves several steps. The primary transcript of the psbB operon undergoes processing that ultimately results in the formation of monocistronic mRNAs for each of the two photosystem II polypeptides and a bicistronic mRNA encoding both subunits of the cytochrome b/f complex (petB and petD) . Kinetically, maturation of the primary transcript is largely a stochastic process. The processing includes excision of class II intervening sequences in petB and petD. These RNA processing events are crucial for proper expression of the genes, as they appear to represent the translationally active components in the non-coordinate dark/light expression of these genes .

How does Cytochrome b6 interact with other components of the photosynthetic electron transport chain?

Cytochrome b6 interacts with several components in the photosynthetic electron transport chain. It forms part of the cytochrome b6f complex, which oxidizes plastoquinone (PQ) molecules from photosystem II and reduces plastocyanin (Pc), which then donates electrons to photosystem I . Research suggests that there is a spatial relationship between PSII and cytochrome b6f complexes in the thylakoid membrane. Colocalization of these complexes creates nanodomains that facilitate the rapid exchange of the lipophilic electron carrier plastoquinone in the crowded thylakoid grana membrane . This organization is crucial because PQ diffusion in thylakoid membranes is 1000-fold slower than in pure liposomes, likely due to protein crowding in the densely packed grana membrane with 70-80% occupancy .

What is the distribution of Cytochrome b6f complexes within thylakoid membrane domains?

  • Biochemical evidence from thylakoids fractionated either mechanically or with the detergent digitonin suggested that cytochrome b6f was distributed fairly evenly between the grana and stromal lamellae .

  • Immunogold labeling and freeze-fracture electron microscopy studies supported this even distribution .

  • Contrarily, fractionation with detergents such as Triton X-100 or n-dodecyl-α-D-maltoside (α-DM) suggested that the grana were devoid of cytochrome b6f and that this complex was confined to the stromal lamellae or grana margins .

Recent research using advanced techniques such as affinity-mapping atomic force microscopy (AFM) has provided evidence for the presence of cytochrome b6f complexes in grana membranes, supporting the hypothesis of microdomains containing PSII, PQ, and cytochrome b6f that facilitate rapid diffusion of PQ over short distances (<20 nm) . This organization would be critical for efficient electron transport given the restricted diffusion of PQ in the crowded thylakoid membrane.

How do PetP and other regulatory subunits affect Cytochrome b6f function?

While not present in spinach (as PetP is found in cyanobacteria and red algae but not in green algae and plants), understanding regulatory subunits like PetP provides valuable insights for comparative studies. In cyanobacteria, the small regulatory subunit PetP promotes the stability and activity of the b6f complex and influences linear electron transport . Research on Thermosynechococcus elongatus has shown that:

  • PetP is associated predominantly with the dimeric form of the cytochrome b6f complex.

  • Cross-linking experiments have revealed that PetP interacts with the N-terminal part of subunit IV (PetD) .

  • The absence of PetP affects the stability of other subunits, particularly leading to a degradation of subunit IV and a massive loss of the Rieske protein in the b6f monomer .

These findings from cyanobacteria provide comparative frameworks for understanding potential regulatory mechanisms that might operate differently in plant systems like spinach.

What methods are used to study the spatial organization of Cytochrome b6f in thylakoid membranes?

Several advanced techniques have been employed to study the spatial organization of cytochrome b6f in thylakoid membranes:

  • Atomic Force Microscopy (AFM): Particularly affinity-mapping AFM techniques have been used to uniquely identify and locate cytochrome b6f complexes. For example, researchers have exploited the selective binding of the electron transfer protein plastocyanin (Pc) to the lumenal membrane surface of the cytochrome b6f complex using a Pc-functionalized AFM probe .

  • Immunogold Labeling: This electron microscopy technique has been used to localize cytochrome b6f in intact thylakoids .

  • Freeze-Fracture Electron Microscopy: This has been employed to compare wild-type and cytochrome b6f-less mutants to identify the location of these complexes .

  • Membrane Fractionation: Various detergent-based fractionation methods have been used, though results can vary based on the specific detergent employed .

  • Spectroscopic Assays: These have been utilized to quantify cytochrome f content in different membrane fractions, providing indirect evidence of cytochrome b6f distribution .

How can researchers express and purify recombinant Spinacia oleracea Cytochrome b6?

Expression and purification of recombinant Spinacia oleracea cytochrome b6 presents significant challenges due to its membrane-embedded nature and complex assembly into the b6f complex. A methodological approach includes:

  • Expression System Selection: Escherichia coli is commonly used for heterologous expression of membrane proteins. For cytochrome b6, specialized E. coli strains capable of properly inserting membrane proteins and incorporating necessary cofactors should be considered .

  • Vector Design: The expression vector should include the petB gene with appropriate fusion tags (e.g., His-tag or Strep-tag) to facilitate purification. Care must be taken to ensure that tags do not interfere with protein folding or function.

  • Membrane Extraction: After expression, isolation of bacterial membranes followed by solubilization using mild detergents such as n-dodecyl-β-D-maltoside (β-DDM) or digitonin is typically performed.

  • Affinity Chromatography: Utilizing the fusion tag for initial purification, followed by size exclusion chromatography to isolate properly folded protein.

  • Functional Validation: Spectroscopic analysis to confirm proper heme incorporation and electron transport capability.

What techniques are available for studying Cytochrome b6 interactions with other proteins?

Several techniques can be employed to study the interactions of cytochrome b6 with other proteins:

  • Pull-Down Assays: As demonstrated with PetP in cyanobacterial studies, tagged proteins can be used to identify interaction partners. For example, Strep-tagged proteins can be bound to Strep-Tactin sepharose columns and used to capture interacting partners, which are then eluted and analyzed by SDS-PAGE and mass spectrometry .

  • Cross-Linking Mass Spectrometry: This technique involves the use of isotope-coded cross-linkers (e.g., BS3-H12/D12) to covalently link interacting proteins. After cross-linking, proteins are digested with trypsin, and the cross-linked peptides are analyzed by high-resolution mass spectrometry. The identification of cross-links based on MS spectra of both light and heavy variants of the cross-linker can pinpoint specific interaction sites .

  • Blue-Native Gel Electrophoresis (BN-PAGE): This technique preserves protein-protein interactions and can be used to analyze complex formation and stability .

  • Co-Immunoprecipitation: Using antibodies specific to cytochrome b6 or its potential interacting partners to pull down protein complexes.

  • Surface Plasmon Resonance (SPR) or Biolayer Interferometry (BLI): These techniques can provide quantitative measurements of binding kinetics between purified proteins.

How can the activity of recombinant Cytochrome b6 be assessed?

Assessing the activity of recombinant cytochrome b6 requires measuring its electron transport capabilities:

  • Spectroscopic Assays: UV-visible spectroscopy can monitor redox changes in the heme groups of cytochrome b6. The reduced and oxidized forms have characteristic absorption spectra that can be used to assess electron transfer activity.

  • Oxygen Consumption Measurements: In reconstituted systems, oxygen electrode measurements can assess electron transport capacity.

  • Artificial Electron Donors/Acceptors: Using compounds like decylplastoquinone as electron donors and artificial acceptors to measure electron transfer rates.

  • Reconstitution into Liposomes: Incorporating purified cytochrome b6 or the entire b6f complex into liposomes allows for measurement of proton translocation coupled to electron transport.

  • Protein Film Voltammetry: This electrochemical technique can directly measure electron transfer properties of immobilized cytochrome b6.

What are common challenges in Cytochrome b6 research and how can they be addressed?

Research on cytochrome b6 faces several challenges:

  • Membrane Protein Solubility: Cytochrome b6 is a membrane protein and can aggregate during purification. Solution: Optimize detergent type, concentration, and buffer conditions. Consider using amphipols or nanodiscs for stabilization.

  • Maintaining Native Structure: The protein may lose its native conformation during purification. Solution: Use mild solubilization conditions, maintain lipids in the preparation, and validate structure by circular dichroism or other biophysical techniques.

  • Complex Assembly: Recombinant cytochrome b6 may not properly assemble with other subunits of the b6f complex. Solution: Consider co-expression strategies with other complex components or reconstitution approaches.

  • Functional Assessment: Determining if the recombinant protein is functionally active. Solution: Develop robust activity assays as outlined in section 3.3.

  • Protein Degradation: Cytochrome b6 and other b6f components can degrade during purification, as observed with subunit IV and Rieske protein in certain preparations . Solution: Include protease inhibitors, optimize purification speed, and maintain appropriate temperature conditions.

How should researchers interpret conflicting data regarding Cytochrome b6f localization?

The debate regarding cytochrome b6f localization in thylakoid membranes exemplifies how different experimental approaches can yield conflicting results. Researchers should:

What protein quantification methods are most reliable for Cytochrome b6f research?

Several quantification methods can be employed in cytochrome b6f research, each with advantages for different applications:

MethodApplicationAdvantagesLimitations
SRM AnalysisAbsolute quantification of protein copies per cellHighly specific and sensitive; can determine subunit stoichiometryRequires specialized mass spectrometry equipment; complex sample preparation
Spectroscopic AssaysQuantification of cytochrome f in membrane fractionsRelatively simple; can be performed on intact membranesIndirect measure of cytochrome b6; potential interference from other cytochromes
ImmunoblottingDetection and relative quantificationSpecific antibody recognition; works in complex mixturesSemi-quantitative; dependent on antibody quality
MALDI-MSMass verification of intact proteinAccurate mass determination; can detect modificationsSample must be relatively pure; not quantitative without standards
LC-MS/MSIdentification and relative quantificationHigh sensitivity; can identify multiple proteins in a sampleComplex data analysis; requires reference standards for absolute quantification

For the most comprehensive analysis, combining multiple methods is recommended. For example, research on cyanobacterial b6f subunits utilized SRM analysis to determine protein copy numbers per cell, yielding valuable data on subunit stoichiometry (Table 1) :

SubunitCopies per Cell ± sd
Rieske2,500 ± 300
SU IV2,700 ± 200
PetP3,300 ± 660
FNR10,500 ± 3,000

How does the electron transport role of Cytochrome b6f influence experimental design?

Understanding the central role of cytochrome b6f in electron transport is crucial for experimental design:

  • Consideration of the Complete Electron Transport Chain: Experiments should account for the interaction of cytochrome b6f with both upstream (PSII, plastoquinone) and downstream (plastocyanin, PSI) components. Studies isolating only one component may miss important functional aspects.

  • Membrane Environment: The lipid environment significantly affects electron transport function. Plastoquinone diffusion in thylakoid membranes is 1000-fold slower than in pure liposomes , emphasizing the importance of appropriate membrane models in in vitro studies.

  • Spatial Organization: The hypothesis of microdomains containing PSII, PQ, and cytochrome b6f that facilitate rapid diffusion of PQ suggests that spatial organization studies should be a key consideration in experimental design.

  • Light Dependence: While light appears to operate at a translational rather than transcriptional or posttranscriptional level for genes in the psbB operon (including petB) , light conditions remain important for functional studies of the assembled complex.

  • Multiple Pools of Electron Carriers: The existence of two pools of PQ with different rates of photoreduction by PSII and slow equilibration between them should be considered when designing electron transport assays.

What emerging technologies could advance Cytochrome b6 research?

Several emerging technologies hold promise for advancing cytochrome b6 research:

  • Cryo-Electron Microscopy: High-resolution structural studies of the entire b6f complex in different functional states can provide insights into electron transport mechanisms and interactions with other proteins.

  • Single-Molecule Techniques: Approaches like single-molecule FRET or tracking could help understand the dynamics of plastoquinone movement between PSII and cytochrome b6f.

  • Advanced AFM Techniques: Building on affinity-mapping AFM , further development of functionalized AFM probes could provide more detailed information about the nanoscale organization of thylakoid membranes.

  • Optogenetic Approaches: Light-controlled activation or inhibition of specific components of the electron transport chain could help dissect the functional relationships between cytochrome b6f and other complexes.

  • CRISPR/Cas9 Genome Editing: Precise modification of the petB gene in chloroplasts could generate new tools for studying cytochrome b6 function in vivo.

How can understanding Cytochrome b6 contribute to broader research fields?

Research on cytochrome b6 has implications for several broader fields:

  • Synthetic Biology: Understanding the assembly and function of cytochrome b6f could inform the design of artificial photosynthetic systems for sustainable energy production.

  • Agricultural Improvement: Knowledge of electron transport efficiency could contribute to strategies for improving crop photosynthetic efficiency and yield.

  • Evolutionary Biology: Comparative studies of cytochrome b6 across different photosynthetic organisms can provide insights into the evolution of photosynthesis.

  • Membrane Protein Biophysics: The study of cytochrome b6 contributes to our broader understanding of membrane protein structure, function, and organization.

  • Systems Biology: Integration of cytochrome b6f into models of the complete photosynthetic apparatus can help understand emergent properties of this complex biological system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.