Recombinant Spinacia oleracea NAD (P)H-quinone oxidoreductase subunit 1, chloroplastic (ndhA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will accommodate your needs to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly packed with blue ice packs. If dry ice packaging is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. To minimize degradation, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is selected during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-365
Protein Length
full length protein
Species
Spinacia oleracea (Spinach)
Target Names
ndhA
Target Protein Sequence
MIIDTTTTKVQAINSFSRLEFLKEVYETIWMLFPILILVLGITIGVLVIVWLEREISASI QQRIGPEYAGPLGILQALADGTKLLFKENLLPSRGDTYLFSIGPSIAVISILLGYLIIPF GSRLVLADLSIGVFLWIAVSSIAPIGLLMSGYGSNNKYSFLGGLRAAAQSISYEIPLTLC VLSISLLSNSSSTVDIVEAQSKYGFWGWNLWRQPIGFIVFIISSLAECERLPFDLPEAEE ELVAGYQTEYSGIKFGLFYVASYLNLLISSLFVTVLYLGGWNLSIPYIFISEFFEINKID GVFGTTIGIFITLAKTFLFLFIPITTRWTLPRLRMDQLLNLGWKFLLPISLGNLLLTTSS QLFSL
Uniprot No.

Target Background

Function
NDH facilitates electron transfer from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be plastoquinone. This process couples the redox reaction with proton translocation, thereby conserving the redox energy in a proton gradient.
Database Links

KEGG: soe:2715584

Protein Families
Complex I subunit 1 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Structural and Functional Characterization of ndhA in Spinach Chloroplasts

Q: What is the structure and function of the NAD(P)H-quinone oxidoreductase subunit 1 (ndhA) in spinach chloroplasts?

A: The ndhA protein is a plastid-encoded subunit of the chloroplast NAD(P)H dehydrogenase (NDH) complex, which is localized to the stroma thylakoids of spinach chloroplasts. This complex participates in photosystem I (PSI) cyclic and chlororespiratory electron transport . Structurally, ndhA functions as part of the NDH complex which exhibits an L-shaped structure similar to bacterial and mitochondrial complex I .

The NDH complex containing ndhA helps prevent over-reduction of the stroma in spinach, which can alleviate oxidative stress under certain conditions . Within the fully assembled NDH complex, ndhA contributes to the NAD(P)H-dependent plastoquinone reduction activity, which is essential for maintaining proper electron flow in the chloroplast. Experimental evidence indicates that the spinach NDH complex interacts with PSI to form a supercomplex that is fully assembled within 48 hours during chloroplast development, transitioning from its monomeric form in etioplasts to the PSI-interacting form in mature chloroplasts .

Methodologies for NDH Complex Isolation and Analysis

Q: What are the optimal methods for isolating and analyzing the native NDH complex containing ndhA from spinach chloroplasts?

A: Isolating and analyzing the native NDH complex containing ndhA from spinach chloroplasts involves several specialized techniques:

  • Extraction and Initial Purification: High-salt extraction followed by ammonium sulfate precipitation has been shown effective for initial purification of chloroplast protein complexes from spinach leaves .

  • Chromatographic Separation: Successful purification protocols employ sequential chromatography, including:

    • Heparin-agarose chromatography

    • Sequence-specific DNA-affinity chromatography (particularly useful if studying DNA-binding properties of the complex)

  • Complex Analysis Techniques:

    • Blue Native PAGE (BN-PAGE): Critical for analyzing intact NDH complex and its interactions with PSI

    • Sucrose Density Gradient Centrifugation: Supports identification of the NDH-PSI supercomplex in vivo

    • Two-dimensional SDS-PAGE: Following BN-PAGE, this allows separation of individual subunits

    • Immunoblot Analysis: Using antibodies against NdhL and PsaA for specific detection

When analyzing the purified complex, gel filtration can determine the apparent molecular weight (59-60 kDa has been reported for some chloroplast DNA-binding proteins from spinach) , while Southwestern blot analysis can reveal structural characteristics such as the dimeric nature of these proteins .

NDH-PSI Supercomplex Formation and Analysis

Q: How does the NDH complex containing ndhA interact with Photosystem I in spinach, and what methods can be used to study this interaction?

A: The NDH complex containing ndhA interacts with Photosystem I (PSI) to form a distinct supercomplex in spinach chloroplasts. This interaction is developmentally regulated, with the supercomplex fully assembled after 48 hours of illumination during chloroplast development .

Methodological approaches to study this interaction include:

  • Temporal Analysis: Examining the time course of supercomplex formation during chloroplast development using:

    • Isolation of total membranes from etiolated and greening leaves

    • Solubilization in detergents (e.g., DM - dodecyl maltoside)

    • BN-PAGE separation followed by two-dimensional SDS-PAGE

  • Immunoblot Detection: Using antibodies specific to:

    • NdhL (for NDH complex detection)

    • PsaA (for PSI detection)

  • Mutant Analysis: Studies with mutants lacking specific NDH subunits (such as NdhL, NdhM, NdhB, NdhD, or NdhF) reveal that:

    • Mutants lacking NdhL and NdhM accumulate an intermediate supercomplex with slightly lower molecular mass

    • This intermediate is unstable in mutants lacking NdhB, NdhD, or NdhF

  • Functional Transition Study: The research shows that the NDH complex exists as a monomer in etioplasts but transitions to interact with PSI in mature chloroplasts, suggesting a functional switch from chlororespiration to PSI cyclic electron transport during development .

Genomic Analysis of ndhA in Spinach

Q: What genomic approaches can be used to study the ndhA gene in spinach, and what has been learned about its genomic context?

A: The ndhA gene is encoded in the spinach chloroplast genome, which has been fully sequenced and characterized. The complete chloroplast chromosome of spinach is a circular DNA molecule of 150,725 nucleotide pairs .

Genomic research approaches include:

Spinach NDH Complex in Response to Stress Conditions

Q: How does the NDH complex containing ndhA respond to various stress conditions in spinach, and what methods can be used to study these responses?

A: The NDH complex in spinach plays a crucial role in alleviating oxidative stress under certain conditions . Research methodologies to study these responses include:

  • Stress Treatment Protocols:

    • Restraint stress models, which have been shown to cause inflammation in the nervous system

    • High light exposure

    • Nutrient limitation studies, particularly examining the effects of varying nitrogen levels (e.g., 3.6 mM vs. 14.3 mM N)

  • Gene Expression Analysis:

    • Real-time PCR to assess changes in ndhA expression levels

    • RNA-seq analysis of transcriptomic changes in response to stress conditions

    • Use of specific markers such as IL-1β and TNF-α as indicators of stress-induced inflammation

  • Protein Analysis:

    • Western blotting to quantify NDH complex subunits

    • BN-PAGE to assess changes in complex assembly under stress conditions

  • Functional Assays:

    • Measurement of reactive oxygen species (ROS) using MitoSox red and flow cytometry

    • Assessment of ratios such as NAD+/NADH levels, which can be increased through NQO1 overexpression

A notable finding is that under light stress conditions, the NDH complex helps prevent over-reduction of the stroma, which is particularly important in mutants defective in the main pathway of PSI cyclic electron transport (such as the pgr5 mutant) .

Light Spectrum Effects on NDH Complex Function

Q: How do different light spectra affect the NDH complex function in spinach, and what experimental designs can be used to study these effects?

A: Different light spectra have significant effects on nitrogen metabolism and, by extension, on proteins involved in electron transport in spinach chloroplasts. Research designs to study these effects include:

Experimental Setup:

  • Controlled Light Environment:

    • LED light regimes with defined spectral compositions, such as:

      • BR: Blue 17%, Green 4%, Red 63%, Far-Red 13%, Infrared 3%

      • BGR: Blue 20%, Green 23%, Red 47%, Far-Red 8%, Infrared 2%

      • GR: Blue 25%, Green 41%, Red 32%, Far-Red 2%

  • Combined Nutritional Variables:

    • Different nitrogen levels (e.g., 3.6 mM and 14.3 mM N) to assess interaction effects with light spectra

Analytical Methods:

  • Biochemical Assays:

    • Measurement of enzyme activities related to nitrogen metabolism:

      • Nitrate reductase (NR)

      • Glutamate dehydrogenase (GDH)

      • Glutamine synthetase (GS)

      • Glutamate synthase (GOGAT)

  • Metabolite Analysis:

    • Quantification of amino acid pools using techniques such as:

      • HPLC or LC-MS/MS

      • Principal Component Analysis (PCA) for multivariate data interpretation

  • Gene Expression Analysis:

    • RNA-seq or qRT-PCR to quantify expression changes in NDH complex genes under different light regimes

Research Findings:
The research shows that adding green light to continuous red and blue light can enhance the activities of nitrogen assimilation enzymes (NR, GDH) under high nitrogen conditions, and improve GDH, GOGAT, and GS activities under limited nitrogen compared to blue-red light only . These metabolic changes likely affect the function and regulation of the NDH complex.

Evolution and Conservation of ndhA in Spinacia Species

Q: How is the ndhA gene conserved across different Spinacia species, and what methods can be used to study its evolution?

A: The ndhA gene is part of the chloroplast genome, which shows interesting patterns of conservation and variation across Spinacia species. Recent studies on chloroplast genomes provide valuable insights:

Comparative Genomic Approaches:

  • Whole Genome Sequencing and Comparison:

    • Complete chloroplast genomes of three Spinacia species (S. oleracea, S. turkestanica, and S. tetrandra) have been sequenced and compared .

    • The three chloroplast genomes exhibit typical quadripartite structure with sizes of:

      • S. oleracea: 150,739 bp

      • S. turkestanica: 150,747 bp

      • S. tetrandra: 150,680 bp

  • Variant Analysis:

    • Only 3 variants were identified between S. oleracea and S. turkestanica

    • 690 variants were found between S. oleracea and S. tetrandra

    • These findings strongly demonstrate the close relationship between S. turkestanica and S. oleracea

  • Comprehensive Variant Dataset:

    • Analysis of 85 Spinacia accessions (61 S. oleracea, 16 S. turkestanica, and 8 S. tetrandra) revealed:

      • 503 SNPs and 83 Indels across the chloroplast genomes

      • Evidence that 13 S. oleracea accessions were derived through introgression from S. turkestanica

  • Phylogenetic Analysis:

    • Phylogenetic studies support the close relationship between S. turkestanica and S. oleracea

    • Molecular dating indicates that S. oleracea split from S. turkestanica approximately 0.8 million years ago, while S. tetrandra diverged from the other species around 6.3 million years ago

These approaches provide a framework for studying the evolution of specific chloroplast genes like ndhA across the Spinacia genus.

Experimental Design for NDH Complex Function Studies

Q: What are the best experimental design approaches for studying NDH complex function in spinach?

A: Designing robust experiments to study NDH complex function requires careful consideration of several factors:

Experimental Design Approaches:

  • Single-Case Experimental Designs (SCEDs):

    • Reversal designs (e.g., ABA design) where baseline (A) and experimental (B) phases are alternated

    • Multiple baseline designs across different conditions

    • Combined reversal and multiple baseline designs

    • These designs focus on demonstrating experimental control of the relationship between treatment and outcome

  • Control Considerations:

    • Randomization of treatment assignment to reduce threats to internal validity

    • Blinding of intervention and data collection when possible

    • Implementation of controls with no-intervention baseline as the initial condition

  • Reproducibility and Validation:

    • Ideally, three replications of treatment effects should be used to demonstrate experimental control

    • Statistical validation approaches such as bootstrap methods with 500 replications can be applied

  • Data Analysis Methods:

    • Multivariate methods for hierarchical clustering

    • Principal Component Analysis (PCA) for multivariate data interpretation

    • Structure analysis to assess population structure when working with different spinach genotypes

  • The Experimental Design Assistant (EDA):

    • A free online tool designed to guide researchers through experiment design

    • Helps ensure use of minimum samples consistent with scientific objectives

    • Provides methods to reduce subjective bias and appropriate statistical analysis

Technical Considerations:
When studying the NDH complex specifically, additional technical considerations include isolation of intact chloroplasts, appropriate detergent solubilization conditions, and preservation of protein complex integrity during analysis.

Functional Complementation Studies of ndhA

Q: How can researchers conduct functional complementation studies to understand ndhA function in spinach?

A: Functional complementation studies are valuable for understanding the specific roles of ndhA in the NDH complex. These approaches involve:

Methodological Approaches:

  • Mutant Analysis:

    • Studying mutants lacking specific NDH subunits reveals important insights about complex assembly and function

    • For example, studies with mutants lacking NdhL and NdhM showed accumulation of an intermediate supercomplex with a slightly lower molecular mass than the NDH-PSI supercomplex

    • This intermediate was found to be unstable in mutants lacking NdhB, NdhD, or NdhF, implying it includes some NDH subunits

  • Complementation Strategies:

    • Transformation with wild-type or modified ndhA genes

    • Expression of the ndhA gene under different promoters to assess dosage effects

    • Creation of chimeric proteins to identify functional domains

  • Phenotypic Analysis:

    • Assessment of physiological parameters including:

      • Photosynthetic electron transport rates

      • Cyclic electron flow around PSI

      • Chlororespiratory activity

      • Growth and development under various conditions

      • Response to stress factors

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation with antibodies against other NDH complex subunits

    • Yeast two-hybrid or split-GFP assays to identify interaction partners

    • BN-PAGE followed by immunoblotting to assess incorporation into complexes

  • Subcellular Localization:

    • Fluorescent protein tagging using approaches like Spinach RNA aptamer technology

    • Optimization of tagging strategies that maintain protein function while allowing visualization

Data Analysis and Interpretation:
Functional complementation data should be analyzed in the context of known NDH complex functions, including its role in preventing over-reduction of the stroma and alleviating oxidative stress under certain conditions .

NDH Complex and Disease Resistance in Spinach

Q: How is the NDH complex involved in disease resistance in spinach, and what methodologies can be used to study this relationship?

A: The relationship between the NDH complex and disease resistance in spinach is an emerging area of research, particularly in the context of downy mildew resistance, which is a major concern for spinach cultivation.

Research Methodologies:

  • Transcriptomic Analysis:

    • RNA-seq analysis of resistant and susceptible spinach cultivars has revealed differential gene expression patterns during pathogen infection

    • For example, in a study comparing resistant (Solomon) and susceptible (Viroflay) spinach cultivars infected with Peronospora effusa (downy mildew):

      • Hypersensitive inducible genes were significantly up-regulated at 48 hours post-inoculation (hpi) in the resistant cultivar

      • Genes involved in zinc finger CCCH protein, glycosyltransferase, and receptor-like protein kinases were expressed from 48-168 hpi in the resistant cultivar

  • Pathway Analysis:

    • The types of genes up-regulated in resistant cultivars suggest that salicylic acid and ethylene signaling pathways mediate resistance

    • Investigation of electron transport chain components, including the NDH complex, can reveal their potential roles in these defense signaling pathways

  • Resistance Gene Analysis:

    • Genome-wide surveys of resistance gene analogues (RGAs) have identified:

      • 695 genes encoding nucleotide-binding site domains

      • Receptor-like protein kinases

      • Receptor-like proteins

      • Transmembrane-coiled coil domains

    • These studies provide context for understanding how electron transport components might interact with resistance mechanisms

  • Genetic Mapping:

    • QTL analysis using techniques such as double-digest restriction-site associated DNA sequencing (ddRAD-seq) has allowed construction of fine molecular linkage maps and pseudomolecules representing the six spinach chromosomes

    • This approach can help identify potential relationships between NDH complex genes and disease resistance loci

Recent Findings:
Interestingly, recent research has provided evidence that downy mildew resistance loci of cultivated spinach are derived from introgression from both wild spinach species (S. turkestanica and S. tetrandra) , highlighting the importance of studying NDH complex variation across different Spinacia species.

NQO1 and NDH: Functional Relationships and Analysis Methods

Q: What is the functional relationship between NQO1 and the NDH complex in spinach, and how can researchers investigate this relationship?

A: NAD(P)H quinone oxidoreductase 1 (NQO1) and the chloroplastic NDH complex both catalyze the reduction of quinones, though in different cellular compartments. Understanding their potential functional relationships requires sophisticated methodological approaches:

Biochemical and Functional Comparisons:

  • Enzyme Activity Assays:

    • NQO1 catalyzes the two-electron reduction of quinones and other organic compounds

    • The NDH complex is involved in NAD(P)H-dependent plastoquinone reduction

    • Comparative enzyme kinetics can reveal similarities and differences in:

      • Substrate specificity

      • Reaction mechanisms

      • Inhibitor sensitivity

  • Structural Analysis:

    • NQO1 functions as a homodimer with two active sites formed from residues from both polypeptide chains

    • The NDH complex has an L-shaped structure similar to bacterial and mitochondrial complex I

    • Structural studies can identify potential shared functional domains or evolutionary relationships

  • Redox Signaling Investigation:

    • Both enzymes impact cellular redox balance:

      • NQO1 reduces free radical load and detoxifies xenobiotics

      • The NDH complex prevents over-reduction of the stroma and alleviates oxidative stress

    • Analysis of redox signaling networks can reveal potential crosstalk between these systems

Experimental Approaches:

  • Gene Expression Correlation:

    • Transcriptomic analysis to identify co-expression patterns

    • Examination of expression under various stress conditions

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation followed by mass spectrometry

    • Bimolecular fluorescence complementation (BiFC)

    • Förster resonance energy transfer (FRET)

  • Metabolic Impact Assessment:

    • Metabolomic profiling to identify shared metabolic pathways

    • Analysis of NAD+/NADH ratios and other relevant metabolites

Relevant Research Findings:
Studies have shown that NQO1 overexpression can reduce oxidative stress by increasing the ratio of NAD+/NADH and silencing information regulator 1 (Sirt1) expression . This finding suggests potential connections between cytosolic NQO1 and chloroplastic NDH in maintaining cellular redox homeostasis, which could be explored through the methodologies outlined above.

Advanced Imaging Techniques for NDH Complex Visualization

Q: What are the most advanced imaging techniques available for visualizing the NDH complex containing ndhA in spinach chloroplasts?

A: Visualizing the NDH complex in spinach chloroplasts requires sophisticated imaging approaches. Recent advances provide several powerful options:

Advanced Imaging Methodologies:

  • RNA Aptamer Technology:

    • Spinach RNA aptamer system provides a genetically encoded approach for RNA imaging

    • This system has been further improved with the development of Spinach2, which exhibits enhanced versatility for fluorescent labeling

    • "Plug-and-play" fluorophores extend the spectral properties:

      • DFHBI (bluish-green fluorescence, 501 nm emission, 447 nm excitation)

      • DFHBI-1T (compatible with GFP filter cubes)

      • DFHBI-2T (allows imaging using YFP filter cubes)

  • Super-Resolution Microscopy:

    • Stimulated emission depletion (STED) microscopy

    • Photoactivated localization microscopy (PALM)

    • Stochastic optical reconstruction microscopy (STORM)

    • These techniques allow visualization beyond the diffraction limit of light

  • Electron Microscopy Approaches:

    • Cryo-electron microscopy for structural analysis of the NDH complex

    • Electron tomography for 3D reconstruction of complex architecture in the thylakoid membrane

    • Immunogold labeling for precise localization of ndhA within the complex

  • Correlative Light and Electron Microscopy (CLEM):

    • Combines the advantages of fluorescence and electron microscopy

    • Allows tracking of the NDH complex at different scales and resolutions

  • Live-Cell Imaging Applications:

    • Using fluorescent protein fusions or RNA aptamers for real-time visualization

    • Critical for understanding dynamic processes such as:

      • NDH complex assembly during chloroplast development (as seen in the transition from monomeric form in etioplasts to the PSI-interacting form in chloroplasts within 48 hours)

      • Responses to changing light conditions

      • Stress-induced rearrangements

Technical Considerations:
When implementing these techniques, researchers must consider:

  • Preservation of native protein structure and function

  • Maintenance of chloroplast integrity

  • Appropriate controls to distinguish specific from non-specific signals

  • Quantitative analysis of imaging data for meaningful comparisons

These advanced imaging approaches provide powerful tools for understanding the structural organization, dynamics, and functional interactions of the NDH complex in spinach chloroplasts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.